Phospho-Profilin 1 (Ser138) Antibody - #AF3739
Product: | Phospho-Profilin 1 (Ser138) Antibody |
Catalog: | AF3739 |
Description: | Rabbit polyclonal antibody to Phospho-Profilin 1 (Ser138) |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 15kD(Calculated). |
Uniprot: | P07737 |
RRID: | AB_2847053 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3739, RRID:AB_2847053.
Fold/Unfold
Actin binding protein; ALS18; Epididymis tissue protein Li 184a; OTTHUMP00000125244; PFN 1; Pfn; PFN1; PROF1_HUMAN; Profilin I; Profilin-1; Profilin1; ProfilinI;
Immunogens
A synthesized peptide derived from human Profilin 1 around the phosphorylation site of Ser138.
- P07737 PROF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
PTMs - P07737 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
Y7 | Phosphorylation | Uniprot | |
T16 | Phosphorylation | Uniprot | |
Y25 | Phosphorylation | Uniprot | |
K26 | Ubiquitination | Uniprot | |
S28 | Phosphorylation | Uniprot | |
S30 | Phosphorylation | Uniprot | |
K38 | Acetylation | Uniprot | |
K38 | Ubiquitination | Uniprot | |
T39 | Phosphorylation | Uniprot | |
T44 | Phosphorylation | Uniprot | |
K54 | Acetylation | Uniprot | |
K54 | Methylation | Uniprot | |
K54 | Ubiquitination | Uniprot | |
R56 | Methylation | Uniprot | |
S57 | Phosphorylation | Uniprot | |
Y60 | Phosphorylation | Uniprot | |
T65 | Phosphorylation | Uniprot | |
K70 | Ubiquitination | Uniprot | |
S72 | Phosphorylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
S85 | Phosphorylation | Uniprot | |
T90 | Phosphorylation | Uniprot | |
K91 | Acetylation | Uniprot | |
K91 | Ubiquitination | Uniprot | |
S92 | Phosphorylation | Uniprot | |
T93 | Phosphorylation | Uniprot | |
T98 | Phosphorylation | Uniprot | |
T102 | Phosphorylation | Uniprot | |
T104 | Phosphorylation | Uniprot | |
K105 | Acetylation | Uniprot | |
K105 | Ubiquitination | Uniprot | |
T106 | Phosphorylation | Uniprot | |
K108 | Acetylation | Uniprot | |
K108 | Ubiquitination | Uniprot | |
T109 | Phosphorylation | Uniprot | |
K116 | Ubiquitination | Uniprot | |
K126 | Acetylation | Uniprot | |
K126 | Ubiquitination | Uniprot | |
K127 | Ubiquitination | Uniprot | |
C128 | S-Nitrosylation | Uniprot | |
Y129 | Phosphorylation | P12931 (SRC) , P35968 (KDR) | Uniprot |
S133 | Phosphorylation | Uniprot | |
S138 | Phosphorylation | Q13464 (ROCK1) | Uniprot |
Y140 | Phosphorylation | Uniprot |
Research Backgrounds
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR.
Phosphorylation at Ser-138 reduces its affinity for G-actin and blocks its interaction with HTT, reducing its ability to inhibit androgen receptor (AR) and HTT aggregation.
Cytoplasm>Cytoskeleton.
Expressed in epididymis (at protein level).
Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio. Found in a complex with XPO6, Ran, ACTB and PFN1. Interacts with VASP. Interacts with HTT.
Belongs to the profilin family.
Research Fields
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.