Product: Phospho-Profilin 1 (Ser138) Antibody
Catalog: AF3739
Description: Rabbit polyclonal antibody to Phospho-Profilin 1 (Ser138)
Application: ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 15kD(Calculated).
Uniprot: P07737
RRID: AB_2847053

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-Profilin 1 (Ser138) Antibody detects endogenous levels of Profilin 1 only when phosphorylated at Ser138.
RRID:
AB_2847053
Cite Format: Affinity Biosciences Cat# AF3739, RRID:AB_2847053.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Actin binding protein; ALS18; Epididymis tissue protein Li 184a; OTTHUMP00000125244; PFN 1; Pfn; PFN1; PROF1_HUMAN; Profilin I; Profilin-1; Profilin1; ProfilinI;

Immunogens

Immunogen:

A synthesized peptide derived from human Profilin 1 around the phosphorylation site of Ser138.

Uniprot:
Gene(ID):
Expression:
P07737 PROF1_HUMAN:

Expressed in epididymis (at protein level).

Sequence:
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

PTMs - P07737 As Substrate

Site PTM Type Enzyme
A2 Acetylation
Y7 Phosphorylation
T16 Phosphorylation
Y25 Phosphorylation
K26 Ubiquitination
S28 Phosphorylation
S30 Phosphorylation
K38 Acetylation
K38 Ubiquitination
T39 Phosphorylation
T44 Phosphorylation
K54 Acetylation
K54 Methylation
K54 Ubiquitination
R56 Methylation
S57 Phosphorylation
Y60 Phosphorylation
T65 Phosphorylation
K70 Ubiquitination
S72 Phosphorylation
S77 Phosphorylation
S85 Phosphorylation
T90 Phosphorylation
K91 Acetylation
K91 Ubiquitination
S92 Phosphorylation
T93 Phosphorylation
T98 Phosphorylation
T102 Phosphorylation
T104 Phosphorylation
K105 Acetylation
K105 Ubiquitination
T106 Phosphorylation
K108 Acetylation
K108 Ubiquitination
T109 Phosphorylation
K116 Ubiquitination
K126 Acetylation
K126 Ubiquitination
K127 Ubiquitination
C128 S-Nitrosylation
Y129 Phosphorylation P12931 (SRC) , P35968 (KDR)
S133 Phosphorylation
S138 Phosphorylation Q13464 (ROCK1)
Y140 Phosphorylation

Research Backgrounds

Function:

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR.

PTMs:

Phosphorylation at Ser-138 reduces its affinity for G-actin and blocks its interaction with HTT, reducing its ability to inhibit androgen receptor (AR) and HTT aggregation.

Subcellular Location:

Cytoplasm>Cytoskeleton.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in epididymis (at protein level).

Subunit Structure:

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio. Found in a complex with XPO6, Ran, ACTB and PFN1. Interacts with VASP. Interacts with HTT.

Family&Domains:

Belongs to the profilin family.

Research Fields

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Shigellosis.

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.