Phospho-IRF2 (Ser225) Antibody - #AF3723
| Product: | Phospho-IRF2 (Ser225) Antibody |
| Catalog: | AF3723 |
| Description: | Rabbit polyclonal antibody to Phospho-IRF2 (Ser225) |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 39kD(Calculated). |
| Uniprot: | P14316 |
| RRID: | AB_2847037 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3723, RRID:AB_2847037.
Fold/Unfold
DKFZp686F0244; Interferon regulatory factor 2; IRF 2; IRF-2; IRF2; IRF2_HUMAN;
Immunogens
A synthesized peptide derived from human IRF2 around the phosphorylation site of Ser225.
Expressed throughout the epithelium of the colon. Also expressed in lamina propria.
- P14316 IRF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
PTMs - P14316 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K29 | Acetylation | Uniprot | |
| K31 | Acetylation | Uniprot | |
| K32 | Acetylation | Uniprot | |
| K75 | Acetylation | Uniprot | |
| K78 | Acetylation | Uniprot | |
| K78 | Sumoylation | Uniprot | |
| K78 | Ubiquitination | Uniprot | |
| S119 | Phosphorylation | Uniprot | |
| K137 | Sumoylation | Uniprot | |
| S143 | Phosphorylation | Uniprot | |
| S144 | Phosphorylation | Uniprot | |
| S148 | Phosphorylation | Uniprot | |
| T162 | Phosphorylation | Uniprot | |
| S163 | Phosphorylation | Uniprot | |
| T164 | Phosphorylation | Uniprot | |
| K166 | Sumoylation | Uniprot | |
| S225 | Phosphorylation | Uniprot | |
| S241 | Phosphorylation | Uniprot | |
| K260 | Sumoylation | Uniprot | |
| K293 | Sumoylation | Uniprot | |
| S333 | Phosphorylation | Uniprot |
Research Backgrounds
Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation.
Acetylated by CBP/ p300 during cell-growth. Acetylation on Lys-75 is required for stimulation of H4 promoter activity.
The major sites of sumoylation are Lys-137 and Lys-293. Sumoylation with SUMO1 increases its transcriptional repressor activity on IRF1 and diminishes its ability to activate ISRE and H4 promoter.
Nucleus.
Expressed throughout the epithelium of the colon. Also expressed in lamina propria.
Interacts with BRD7, IRF2BP1 and IRF2BP2. Interacts with CREBBP in growing cells; the interaction acetylates IRF2 and regulates IRF2-dependent H4 promoter activity.
Belongs to the IRF family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.