Synaptophysin Antibody - #AF0257
![](/images/pubmed.gif)
Product: | Synaptophysin Antibody |
Catalog: | AF0257 |
Description: | Rabbit polyclonal antibody to Synaptophysin |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Xenopus |
Mol.Wt.: | 38kDa; 34kD(Calculated). |
Uniprot: | P08247 |
RRID: | AB_2833432 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0257, RRID:AB_2833432.
Fold/Unfold
Major synaptic vesicle protein p38; MRX96; MRXSYP; Syn p38; Synaptophysin; Syp; SYPH; SYPH_HUMAN; SypI;
Immunogens
Expressed in the brain, with expression in the hippocampus, the neuropil in the dentate gyrus, where expression is higher in the outer half of the molecular layer than in the inner half, and in the neuropil of CA4 and CA3.
- P08247 SYPH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P08247 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y73 | Phosphorylation | Uniprot | |
Y81 | Phosphorylation | Uniprot | |
Y250 | Phosphorylation | Uniprot |
Research Backgrounds
Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).
Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation.
Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Multi-pass membrane protein. Cell junction>Synapse>Synaptosome.
Expressed in the brain, with expression in the hippocampus, the neuropil in the dentate gyrus, where expression is higher in the outer half of the molecular layer than in the inner half, and in the neuropil of CA4 and CA3.
Homohexamer or homotetramer. Interacts with SRCIN1. Interacts with VAMP2; the interaction is inhibit by interaction of VAPM2 with SEPT8 (By similarity).
The calcium-binding activity is thought to be localized in the cytoplasmic tail of the protein.
Belongs to the synaptophysin/synaptobrevin family.
References
Application: WB Species: Rat Sample: Hippocampus tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.