Phospho-CRTC3 (Ser162) Antibody | Affinity Biosciences

Product:	Phospho-CRTC3 (Ser162) Antibody
Catalog:	AF3576
Description:	Rabbit polyclonal antibody to Phospho-CRTC3 (Ser162)
Application:	ELISA(peptide)
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	67kD(Calculated).
Uniprot:	Q6UUV7
RRID:	AB_2846890

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$350	In stock
200ul	$450	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

Phospho-CRTC3 (Ser162) Antibody detects endogenous levels of CRTC3 only when phosphorylated at Ser162.

RRID:

AB_2846890
Cite Format: Affinity Biosciences Cat# AF3576, RRID:AB_2846890.

Conjugate:

Unconjugated.

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

CREB regulated transcription coactivator 3; CREB-regulated transcription coactivator 3; CRTC 3; CRTC3; CRTC3_HUMAN; FLJ21868; TORC 3; TORC-3; TORC3; Transducer of CREB protein 3; Transducer of regulated cAMP response element binding protein (CREB) 3; Transducer of regulated cAMP response element binding protein 3; Transducer of regulated cAMP response element-binding protein 3; Transducer of regulated CREB protein 3;

Immunogens

Immunogen:

A synthesized peptide derived from human CRTC3 around the phosphorylation site of Ser162.

Uniprot:

Q6UUV7(CRTC3_HUMAN) >>Visit HPA database.

Gene(ID):

CRTC3(64784)

Expression:

Q6UUV7 CRTC3_HUMAN:

Predominantly expressed in B and T lymphocytes. Highest levels in lung. Also expressed in brain, colon, heart, kidney, ovary, and prostate. Weak expression in liver, pancreas, muscle, small intestine, spleen and stomach.

Sequence:

Q6UUV7 CRTC3_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL

PTMs - Q6UUV7 As Substrate

Q6UUV7

Site	PTM Type	Enzyme	Source
S4	Phosphorylation		Uniprot
K18	Sumoylation		Uniprot
K18	Ubiquitination		Uniprot
T56	Phosphorylation		Uniprot
Y58	Phosphorylation		Uniprot
S62	Phosphorylation	P57059 (SIK1)	Uniprot
S67	Phosphorylation		Uniprot
R87	Methylation		Uniprot
S99	Phosphorylation		Uniprot
S135	Phosphorylation		Uniprot
K147	Sumoylation		Uniprot
T160	Phosphorylation		Uniprot
S162	Phosphorylation	P57059 (SIK1)	Uniprot
K174	Sumoylation		Uniprot
K213	Sumoylation		Uniprot
K222	Sumoylation		Uniprot
K226	Sumoylation		Uniprot
K232	Sumoylation		Uniprot
K232	Ubiquitination		Uniprot
S238	Phosphorylation		Uniprot
S273	Phosphorylation		Uniprot
S305	Phosphorylation		Uniprot
S321	Phosphorylation		Uniprot
S327	Phosphorylation		Uniprot
S329	Phosphorylation	P57059 (SIK1)	Uniprot
S332	Phosphorylation		Uniprot
S344	Phosphorylation		Uniprot
S345	Phosphorylation		Uniprot
T352	Phosphorylation		Uniprot
S353	Phosphorylation		Uniprot
S363	Phosphorylation		Uniprot
S368	Phosphorylation		Uniprot
S370	Phosphorylation	P57059 (SIK1)	Uniprot
S373	Phosphorylation		Uniprot
S375	Phosphorylation		Uniprot
S380	Phosphorylation		Uniprot
S391	Phosphorylation		Uniprot
T394	Phosphorylation		Uniprot
S396	Phosphorylation		Uniprot
S406	Phosphorylation		Uniprot
S410	Phosphorylation		Uniprot
S411	Phosphorylation		Uniprot
T412	Phosphorylation		Uniprot
S413	Phosphorylation		Uniprot
S432	Phosphorylation		Uniprot
T436	Phosphorylation		Uniprot
S443	Phosphorylation		Uniprot
Y448	Phosphorylation		Uniprot
T455	Phosphorylation		Uniprot
S524	Phosphorylation		Uniprot
T577	Phosphorylation		Uniprot

Research Backgrounds

Q6UUV7_CRTC3_HUMAN

Function:

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).

PTMs:

Phosphorylation/dephosphorylation states of Ser-273 are required for regulating transduction of CREB activity (By similarity). CRTCs/TORCs are inactive when phosphorylated, and active when dephosphorylated at this site (By similarity). May be phosphorylated at Ser-391 by MAPK3/ERK1 and/or MAPK1/ERK2 or by some cyclin-dependent kinases such as CDK1,CDK2 or CDK5. Following adenylyl cyclase activation, dephosphorylated at Ser-162 and Ser-273 resulting in its dissociation from 14-3-3 proteins probably promoting CRTC3 translocation into the nucleus.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Appears to be mainly nuclear (PubMed:15454081). Translocates to the nucleus following adenylyl cyclase or MAP kinase activation (PubMed:30611118).

Tissue Specificity:

Subunit Structure:

Binding, as a tetramer, through its N-terminal region, with the bZIP domain of CREB1 enhances recruitment of TAF4 to the promoter. 'Arg-314' in the bZIP domain of CREB1 is essential for this interaction. Interacts (when phosphorylated at Ser-162 and Se-273) with 14-3-3 proteins. Interacts with YWHAE. Interacts (when phosphorylated at Ser-391) with phosphatase PP2A catalytic subunit PPP2CA and regulatory subunits PPP2R1A and PPP2R2A. Interacts, via the N-terminal with the ankyrin repeats of BCL3, to form a complex with CREB1 on CRE and TxRE responsive elements and represses HTLV-1 LTR-mediated transcription.

(Microbial infection) Interacts with HTLV-1 protein Tax; this interaction enhances tax transcriptional activity.

Family&Domains:

Belongs to the TORC family.

Research Fields

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Phospho-CRTC3 (Ser162) Antibody - #AF3576