Phospho-RAD18 (Ser99) Antibody - #AF3529

(4)  
Product: Phospho-RAD18 (Ser99) Antibody
Catalog: AF3529
Description: Rabbit polyclonal antibody to Phospho-RAD18 (Ser99)
Application: IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 56kD(Calculated).
Uniprot: Q9NS91
RRID: AB_2846843

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-RAD18 (Ser99) Antibody detects endogenous levels of RAD18 only when phosphorylated at Ser99.
RRID:
AB_2846843
Cite Format: Affinity Biosciences Cat# AF3529, RRID:AB_2846843.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2810024C04Rik; DNA repair protein rad18; E3 ubiquitin-protein ligase RAD18; EC 6.3.2.-; hHR 18; hHR18; hRAD 18; hRAD18; MGC156682; Postreplication repair E3 ubiquitin-protein ligase RAD18; Postreplication repair protein hRAD18p; Postreplication repair protein RAD18; RAD 18; RAD18; RAD18 homolog (S. cerevisiae); RAD18 homolog; RAD18 S. cerevisiae homolog; RAD18 S. cerevisiae homolog of; RAD18 transcript variant; RAD18_HUMAN; Rad18sc; Radiation sensitivity protein 18; RING finger protein 73; RNF 73; RNF73; Structural maintenance of chromosomes protein 6; YCR066W; YCR66W;

Immunogens

Immunogen:

A synthesized peptide derived from human RAD18 around the phosphorylation site of Ser99.

Uniprot:

Q9NS91(RAD18_HUMAN) >>Visit HPA database.

Gene(ID):
RAD18(56852)
Sequence:
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN

PTMs - Q9NS91 As Substrate

Site PTM Type Enzyme
M1 Acetylation
K17 Ubiquitination
K52 Ubiquitination
S55 Phosphorylation
Y56 Phosphorylation
K57 Ubiquitination
T66 Phosphorylation
K73 Ubiquitination
K83 Ubiquitination
S99 Phosphorylation P24941 (CDK2)
K102 Sumoylation
K102 Ubiquitination
S103 Phosphorylation
S106 Phosphorylation
S107 Phosphorylation
S108 Phosphorylation
S109 Phosphorylation
K110 Sumoylation
K110 Ubiquitination
K115 Sumoylation
K115 Ubiquitination
T118 Phosphorylation
S122 Phosphorylation
S125 Phosphorylation
K127 Sumoylation
K127 Ubiquitination
S142 Phosphorylation
S144 Phosphorylation
K151 Sumoylation
K151 Ubiquitination
K154 Ubiquitination
S155 Phosphorylation
K156 Ubiquitination
S158 Phosphorylation
K161 Ubiquitination
S164 Phosphorylation
K168 Ubiquitination
K170 Ubiquitination
S174 Phosphorylation
K186 Sumoylation
K186 Ubiquitination
K197 Sumoylation
K197 Ubiquitination
K201 Sumoylation
K201 Ubiquitination
K218 Ubiquitination
K229 Sumoylation
K245 Ubiquitination
R254 Methylation
K257 Sumoylation
K257 Ubiquitination
K259 Ubiquitination
K261 Sumoylation
K261 Ubiquitination
K271 Ubiquitination
K276 Ubiquitination
K309 Ubiquitination
K318 Sumoylation
K318 Ubiquitination
S322 Phosphorylation
T327 Phosphorylation
K328 Sumoylation
K328 Ubiquitination
K333 Ubiquitination
K341 Ubiquitination
K347 Sumoylation
K347 Ubiquitination
K363 Ubiquitination
S368 Phosphorylation
K370 Acetylation
K370 Sumoylation
K370 Ubiquitination
K376 Sumoylation
K376 Ubiquitination
K383 Ubiquitination
S385 Phosphorylation
S386 Phosphorylation
S403 Phosphorylation Q13315 (ATM)
S409 Phosphorylation
S434 Phosphorylation O00311 (CDC7)
K462 Ubiquitination
T468 Phosphorylation
S471 Phosphorylation
S483 Phosphorylation

Research Backgrounds

Function:

E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity.

Subcellular Location:

Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Note: Associates with chromatin (PubMed:25931565). Colocalizes with SLF1 in the nucleus and to centrosomes (PubMed:15632077). Relocalizes with SLF1 to nuclear foci in response to DNA damage (PubMed:22036607). Accumulates with the SLF1-SLF2 and SMC5-SMC6 complexes at replication-coupled DNA interstrand repair and DNA double-strand breaks (DSBs) sites on chromatin in a ubiquitin-dependent manner (PubMed:25931565).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer. Interacts with UBE2A and UBE2B, one homodimer binding one molecule of UBE2B. Interacts with SHPRH. Interacts with HLTF. Interacts with SPRTN; leading to enhance chromatin association of RAD18 and RAD18-mediated PCNA ubiquitination and translesion DNA synthesis. Interacts (via C-terminus and phosphorylated form) with SLF1 (via BRCT domains); this interaction is required for efficient repair of UV-induced DNA damage. Interacts with SLF2. Interacts with SMC5; this interaction is increased in a SLF1 or SLF2-dependent manner.

Family&Domains:

Belongs to the RAD18 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.