Phospho-AurB/C (Thr236/Thr202) Antibody - #AF3512
Product: | Phospho-AurB/C (Thr236/Thr202) Antibody |
Catalog: | AF3512 |
Description: | Rabbit polyclonal antibody to Phospho-AurB/C (Thr236/Thr202) |
Application: | IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 36kD(Calculated). |
Uniprot: | Q9UQB9 |
RRID: | AB_2846826 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3512, RRID:AB_2846826.
Fold/Unfold
;AURKC; AIE 2; Aie1; AIE2; AIK 3; AIK3; ARK 3; ARK-3; ARK3; Aur C; AurC; Aurkc; AURKC_HUMAN; aurora 3; Aurora C; Aurora kinase C; aurora related kinase 3; Aurora-related kinase 3; Aurora/Ipl1 related kinase 3; Aurora/Ipl1-related kinase 3; Aurora/Ipl1/Eg2 protein 2; EC 2.7.11.1; Serine threonine protein kinase 13; serine/threonine kinase 13 (aurora/IPL1 like); serine/threonine protein kinase aurora C; Serine/threonine-protein kinase 13; Serine/threonine-protein kinase aurora-C; SPGF5; STK13;
Immunogens
A synthesized peptide derived from human AurB/C around the phosphorylation site of Thr236/202.
Isoform 1 and isoform 2 are expressed in testis. Elevated expression levels were seen only in a subset of cancer cell lines such as Hep-G2, Huh-7 and HeLa. Expression is maximum at M phase.
- Q9UQB9 AURKC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS
PTMs - Q9UQB9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S32 | Phosphorylation | Uniprot | |
K53 | Ubiquitination | Uniprot | |
Y58 | Phosphorylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
S77 | Phosphorylation | Uniprot | |
K130 | Ubiquitination | Uniprot | |
K197 | Acetylation | Uniprot | |
K197 | Ubiquitination | Uniprot | |
T198 | Phosphorylation | Uniprot | |
T202 | Phosphorylation | Uniprot | |
Y205 | Phosphorylation | Uniprot | |
S271 | Phosphorylation | Uniprot |
PTMs - Q9UQB9 As Enzyme
Substrate | Site | Source |
---|---|---|
O75410 (TACC1) | S228 | Uniprot |
P68431 (HIST1H3J) | S11 | Uniprot |
Research Backgrounds
Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Plays also a role in meiosis and more particularly in spermatogenesis. Has redundant cellular functions with AURKB and can rescue an AURKB knockdown. Like AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC phosphorylates the CPC complex subunits BIRC5/survivin and INCENP leading to increased AURKC activity. Phosphorylates TACC1, another protein involved in cell division, at 'Ser-228'.
Nucleus. Chromosome. Chromosome>Centromere. Cytoplasm>Cytoskeleton>Spindle.
Note: Distributes in the condensed chromosomes during prophase to metaphase. After entering anaphase, there is a dissociation from separated chromosomes and a redistribution to midzone microtubules, and finally remains in the midbody during cytokinesis.
Isoform 1 and isoform 2 are expressed in testis. Elevated expression levels were seen only in a subset of cancer cell lines such as Hep-G2, Huh-7 and HeLa. Expression is maximum at M phase.
Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB or AURKC; predominantly independent AURKB- and AURKC-containing complexes exist; in the complex interacts directly with BIRC5/survivin and INCENP. Interacts with TACC1.
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.