Product: Phospho-FUNDC1 (Ser17) antibody
Catalog: AF0001
Description: Rabbit polyclonal antibody to Phospho-FUNDC1 (Ser17)
Application: WB
Reactivity: Human
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 17KD; 17kD(Calculated).
Uniprot: Q8IVP5
RRID: AB_2846773

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(88%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
Phospho-FUNDC1 (Ser17) antibody detects endogenous levels of FUNDC1 only when phosphorylated at Serine 17.
RRID:
AB_2846773
Cite Format: Affinity Biosciences Cat# AF0001, RRID:AB_2846773.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FUN14 domain containing 1; FUN14 domain containing protein 1; FUN14 domain-containing protein 1; FUND1_HUMAN; fundc1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q8IVP5 FUND1_HUMAN:

Widely expressed.

Sequence:
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Chicken
100
Rabbit
100
Dog
88
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q8IVP5 As Substrate

Site PTM Type Enzyme
Y11 Phosphorylation
S13 Phosphorylation
S17 Phosphorylation
Y18 Phosphorylation
S40 Phosphorylation
S41 Phosphorylation
K119 Ubiquitination

Research Backgrounds

Function:

Acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control.

PTMs:

Phosphorylation at Tyr-18 by SRC inhibits activation of mitophagy. Following hypoxia, dephosphorylated at Tyr-18, leading to interaction with MAP1 LC3 family proteins and triggering mitophagy.

Subcellular Location:

Mitochondrion outer membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed.

Subunit Structure:

Interacts (via YXXL motif) with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.

Family&Domains:

The YXXL motif mediates the interaction with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.

Belongs to the FUN14 family.

References

1). Diyuan Zhou et al. TBK1 Facilitates GLUT1-Dependent Glucose Consumption by suppressing mTORC1 Signaling in Colorectal Cancer Progression. International Journal of Biological Sciences 2022 May 9;18(8):3374-3389. (PubMed: 35637944) [IF=9.2]

2). Liu et al. Hypoxia‑induced mitophagy regulates proliferation, migration and odontoblastic differentiation of human dental pulp cells through FUN14 domain‑containing 1. International Journal of Molecular Medicine 2022 May;49(5):72. (PubMed: 35362539) [IF=5.4]

Application: IHC    Species: Human    Sample: HDPCs

Figure 1 Expressions of inflammatory cytokines, HIF-1α and FUNDC1 in healthy and pulpitis tissues. (A) mRNA expression of IL-1β, IL-6, IL-8 and TNF-α in human healthy and pulpitis tissues. mRNA expression of (B) HIF-1α and (C) FUNDC1 in human healthy and pulpitis tissues. (D) Representative immunostaining images of HIF-1α and FUNDC1 in human healthy or inflamed dental pulp tissues. Scale bars are 100 and 25 µm, respectively. Results are presented as the means ± SD from ≥ three independent experiments. *P<0.05, **P<0.01 and ***P<0.001 vs. healthy. HIF-1α, hypoxia-inducible factor-1α; FUNDC1, FUN14 domain-containing 1.

3). Wang Y et al. LAMP2A regulates the balance of mesenchymal stem cell adipo-osteogenesis via the Wnt/β-catenin/GSK3β signaling pathway. Journal of Molecular Medicine 2023 May 10; (PubMed: 37162558) [IF=4.7]

4). Wu Y et al. Molybdenum and Cadmium Co-induce Mitochondrial Quality Control Disorder via FUNDC1-Mediated Mitophagy in Sheep Kidney. Frontiers in Veterinary Science 2022 Jan 28;9:842259. (PubMed: 35155662) [IF=3.2]

Application: WB    Species: Sheep    Sample: kidney tissue

Figure 6 Effects of Mo and/or Cd on immunofluorescence of LC3, mitophagy-related mRNA and protein expression levels. (A) The mRNA levels of FUNDC1, LC3A, LC3B and PGAM5. (B) The western blot results of FUNDC1, p-FUNDC1 and LC3. (C) The quantification of FUNDC1, p-FUNDC1 (Ser17) and LC3II/LC3I protein levels. (D) Immunofluorescence co-location of COX IV and LC3 at day 50. In the images, the nucleus staining is shown in blue, COX IV staining is shown in green, LC3 staining is shown in red, and the signals of colocalization are shown in merged images. (E) Pearson coefficient of the colocalization of COX IV and LC3. Data are expressed as means ± SD (n = 6). “*” indicates significant difference compared to the corresponding control (*P < 0.05, **P < 0.01). “#” indicates statistically significant difference between corresponding groups (#P < 0.05, ##P < 0.01).

5). Xia et al. Moxibustion alleviates chronic heart failure by regulating mitochondrial dynamics and inhibiting autophagy. Experimental and Therapeutic Medicine 2022 May;23(5):359. (PubMed: 35493422) [IF=2.7]

Application: WB    Species: Rat    Sample:

Figure 6 The effects of MOX on FUNDC1 pathway. (A) The expression levels of ULK1, PGAM5, FUNDC1, p-FUNDC1 and GAPDH. (B) ULK1 relative to GAPDH, (C) PGAM5 relative to GAPDH, (D) FUNDC1 relative to GAPDH. (E) p-FUNDC1 relative to GAPDH. (F) ULK mRNA levels. (G) PGAM5 mRNA levels. (H) FUNDC1 mRNA levels. **P<0.05 vs. C group and #P<0.05 vs. DOX group. Protein levels were measured by western blotting. ULK1, PGAM5 and FUNDC1 mRNA levels were measured by RT-qPCR. Data are mean ± standard deviation from five independent experiments (n=13-20). MOX moxibustion; FUNDC1, FUN14 domain-containing protein 1; ULK1, Unc-51 Like Autophagy Activating Kinase 1; PGAM5, phosphoglycerate mutase family member 5; p-, phosphorylated; DOX, doxorubicin; BEN, benazepril C, control.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.