Claudin 17 Antibody - #DF13751
Product: | Claudin 17 Antibody |
Catalog: | DF13751 |
Description: | Rabbit polyclonal antibody to Claudin 17 |
Application: | WB |
Reactivity: | Human, Mouse |
Mol.Wt.: | 24kDa; 25kD(Calculated). |
Uniprot: | P56750 |
RRID: | AB_2846770 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13751, RRID:AB_2846770.
Fold/Unfold
CLDN17; Human CLDN17 gene for claudin 17;
Immunogens
In the kidney, expressed in the proximal tubule and in the Henle's loop. In the distal convoluted tubule, not expressed in all tubules. Not detected in the collecting duct (at protein level).
- P56750 CLD17_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
PTMs - P56750 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S38 | Phosphorylation | Uniprot | |
Y202 | Phosphorylation | Uniprot |
Research Backgrounds
Channel-forming tight junction protein with selectivity for anions, including chloride and bicarbonate, and for solutes smaller than 9 Angstrom in diameter. In the kidney proximal tubule, may be involved in quantitative reabsorption of filtered anions. Does not affect water permeability.
Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.
In the kidney, expressed in the proximal tubule and in the Henle's loop. In the distal convoluted tubule, not expressed in all tubules. Not detected in the collecting duct (at protein level).
Interacts with OCLN.
Belongs to the claudin family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.