LHX6 Antibody - #DF13749
Product: | LHX6 Antibody |
Catalog: | DF13749 |
Description: | Rabbit polyclonal antibody to LHX6 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Dog |
Mol.Wt.: | 40kDa; 40kD(Calculated). |
Uniprot: | Q9UPM6 |
RRID: | AB_2846768 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13749, RRID:AB_2846768.
Fold/Unfold
LHX 6; LHX 6.1; LHX6; LHX6.1; LHX6_HUMAN; LIM homeobox 6; LIM homeobox protein 6; LIM homeodomain protein 6.1; LIM/homeobox protein Lhx6; LIM/homeobox protein Lhx6.1; MGC119542; MGC119544; MGC119545; OTTHUMP00000064113; OTTHUMP00000064114;
Immunogens
- Q9UPM6 LHX6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGQASPCTPSTPSVCSPPSAASSVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UPM6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y185 | Phosphorylation | Uniprot | |
T187 | Phosphorylation | Uniprot |
Research Backgrounds
Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex (By similarity).
Nucleus.
Interacts with LDB1 (via the LIM zinc-binding domains).
References
Application: IF/ICC Species: Mouse Sample: MTEC cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.