Placental lactogen Antibody - #DF13739
Product: | Placental lactogen Antibody |
Catalog: | DF13739 |
Description: | Rabbit polyclonal antibody to Placental lactogen |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 24kDa; 25kD(Calculated). |
Uniprot: | P0DML3 |
RRID: | AB_2846758 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13739, RRID:AB_2846758.
Immunogens
- P0DML3 CSH2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
PTMs - P0DML3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S158 | Phosphorylation | Uniprot |
Research Backgrounds
Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Secreted.
Can be found in a monomeric as well as dimeric form.
Belongs to the somatotropin/prolactin family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.