LIF Antibody - #DF13730
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13730, RRID:AB_2846749.
Fold/Unfold
CDF; Cholinergic Differentiation Factor; D factor; DIA; Differentiation inducing factor; differentiation inhibitory activity; Differentiation stimulating factor; Differentiation-stimulating factor; Emfilermin; Hepatocyte stimulating factor III; HILDA; Human interleukin in DA cells; Leukemia inhibitory factor; LIF; LIF_HUMAN; Melanoma derived LPL inhibitor; Melanoma-derived LPL inhibitor; MLPLI;
Immunogens
- P15018 LIF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P15018 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| N31 | N-Glycosylation | Uniprot | |
| N56 | N-Glycosylation | Uniprot | |
| N85 | N-Glycosylation | Uniprot | |
| N95 | N-Glycosylation | Uniprot | |
| N118 | N-Glycosylation | Uniprot | |
| N138 | N-Glycosylation | Uniprot |
Research Backgrounds
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Secreted.
Belongs to the LIF/OSM family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.