p40 Antibody - #DF13704
| Product: | p40 Antibody |
| Catalog: | DF13704 |
| Description: | Rabbit polyclonal antibody to p40 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 40kDa; 41kD(Calculated). |
| Uniprot: | Q7Z6M1 |
| RRID: | AB_2846723 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13704, RRID:AB_2846723.
Fold/Unfold
40 kDa Rab9 effector protein; 8430412M01Rik; 9530020d24rik; AV073337; bA65N13.1; C87311; DKFZp686P1077; OTTHUMP00000022126; OTTMUSP00000012898; OTTMUSP00000012899; OTTMUSP00000041318; p40; RAB9 effector p40; Rab9 effector protein with Kelch motifs; RAB9p40; RABEK_HUMAN; RABEPK; RABEPK protein; RGD1310612; RP11 65N13.1; RP23-446N16.2;
Immunogens
- Q7Z6M1 RABEK_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q7Z6M1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Phosphorylation | Uniprot | ||
| K12 | Ubiquitination | Uniprot | |
| K15 | Ubiquitination | Uniprot | |
| T17 | Phosphorylation | Uniprot | |
| Y19 | Phosphorylation | Uniprot | |
| K46 | Ubiquitination | Uniprot | |
| K49 | Ubiquitination | Uniprot | |
| S61 | Phosphorylation | Uniprot | |
| S63 | Phosphorylation | Uniprot | |
| K72 | Ubiquitination | Uniprot | |
| K81 | Ubiquitination | Uniprot | |
| S110 | Phosphorylation | Uniprot | |
| S133 | Phosphorylation | Uniprot | |
| R160 | Methylation | Uniprot | |
| K169 | Ubiquitination | Uniprot | |
| S191 | Phosphorylation | Uniprot | |
| K229 | Ubiquitination | Uniprot | |
| K232 | Ubiquitination | Uniprot | |
| S314 | Phosphorylation | Uniprot | |
| S316 | Phosphorylation | Uniprot | |
| T318 | Phosphorylation | Uniprot | |
| K325 | Ubiquitination | Uniprot |
Research Backgrounds
Rab9 effector required for endosome to trans-Golgi network (TGN) transport.
Phosphorylated on Ser residues most probably by PIP5K3.
Cytoplasm. Endosome membrane.
Note: Interaction with PIP5K3 and subsequent phosphorylation recruits it to the endosomal membrane.
Interacts with PIP5K3. Interacts with RAB9 in its GTP-bound conformation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.