AADACL1 Antibody - #DF13688
| Product: | AADACL1 Antibody |
| Catalog: | DF13688 |
| Description: | Rabbit polyclonal antibody to AADACL1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 45kDa; 46kD(Calculated). |
| Uniprot: | Q6PIU2 |
| RRID: | AB_2846707 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13688, RRID:AB_2846707.
Fold/Unfold
Arylacetamide deacetylase like 1; Arylacetamide deacetylase-like 1; NCEH; Nceh1; NCEH1_HUMAN; Neutral cholesterol ester hydrolase 1; Neutral cholesterol ester hydrolase;
Immunogens
Expressed in monocyte-derived macrophages. Up-regulated in invasive melanoma and breast carcinoma cell lines.
- Q6PIU2 NCEH1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q6PIU2 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T85 | Phosphorylation | Uniprot | |
| K100 | Ubiquitination | Uniprot | |
| S144 | Phosphorylation | Uniprot | |
| Y168 | Phosphorylation | Uniprot | |
| T240 | Phosphorylation | Uniprot | |
| N287 | N-Glycosylation | Uniprot | |
| S295 | Phosphorylation | Uniprot | |
| T297 | Phosphorylation | Uniprot | |
| K301 | Ubiquitination | Uniprot |
Research Backgrounds
Hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. May be responsible for cholesterol ester hydrolysis in macrophages, thereby contributing to the development of atherosclerosis. Also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds. May contribute to cancer pathogenesis by promoting tumor cell migration.
N-glycosylated.
Membrane>Single-pass type II membrane protein. Microsome.
Expressed in monocyte-derived macrophages. Up-regulated in invasive melanoma and breast carcinoma cell lines.
Belongs to the 'GDXG' lipolytic enzyme family.
Research Fields
· Organismal Systems > Digestive system > Cholesterol metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.