RBM14 Antibody - #DF13645
Product: | RBM14 Antibody |
Catalog: | DF13645 |
Description: | Rabbit polyclonal antibody to RBM14 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 69kDa; 69kD(Calculated). |
Uniprot: | Q96PK6 |
RRID: | AB_2846664 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13645, RRID:AB_2846664.
Fold/Unfold
CoAA; Coactivator Activator; RBM 14; RBM14; RNA binding motif protein 14; RNA binding protein 14; RRM containing coactivator activator/modulator; SIP; Synaptotagmin interacting protein; SYT interacting protein 1; SYT interacting protein; SYT interacting protein SIP; SYTIP 1; SYTIP1;
Immunogens
Expressed in all tissues tested, including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes.
- Q96PK6 RBM14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96PK6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S92 | Phosphorylation | Uniprot | |
K112 | Acetylation | Uniprot | |
K112 | Ubiquitination | Uniprot | |
Y114 | Phosphorylation | Uniprot | |
K121 | Ubiquitination | Uniprot | |
K126 | Sumoylation | Uniprot | |
K126 | Ubiquitination | Uniprot | |
K135 | Acetylation | Uniprot | |
K135 | Sumoylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
K138 | Sumoylation | Uniprot | |
S147 | Phosphorylation | Uniprot | |
K149 | Sumoylation | Uniprot | |
K149 | Ubiquitination | Uniprot | |
K152 | Ubiquitination | Uniprot | |
K153 | Sumoylation | Uniprot | |
K153 | Ubiquitination | Uniprot | |
S161 | Phosphorylation | Uniprot | |
K164 | Acetylation | Uniprot | |
K164 | Ubiquitination | Uniprot | |
T165 | Phosphorylation | Uniprot | |
K167 | Ubiquitination | Uniprot | |
T206 | Phosphorylation | Uniprot | |
S215 | Phosphorylation | Uniprot | |
S220 | Phosphorylation | Uniprot | |
S225 | Phosphorylation | Uniprot | |
Y226 | Phosphorylation | Uniprot | |
T231 | Phosphorylation | Uniprot | |
T236 | Phosphorylation | Uniprot | |
Y237 | Phosphorylation | Uniprot | |
R238 | Methylation | Uniprot | |
S242 | Phosphorylation | Uniprot | |
S244 | O-Glycosylation | Uniprot | |
S244 | Phosphorylation | Uniprot | |
Y249 | Phosphorylation | Uniprot | |
R250 | Methylation | Uniprot | |
S254 | O-Glycosylation | Uniprot | |
S254 | Phosphorylation | Uniprot | |
S256 | O-Glycosylation | Uniprot | |
S256 | Phosphorylation | Uniprot | |
Y261 | Phosphorylation | Uniprot | |
T263 | Phosphorylation | Uniprot | |
T267 | Phosphorylation | Uniprot | |
S272 | Phosphorylation | Uniprot | |
Y273 | Phosphorylation | Uniprot | |
R274 | Methylation | Uniprot | |
S278 | Phosphorylation | Uniprot | |
S280 | O-Glycosylation | Uniprot | |
S280 | Phosphorylation | Uniprot | |
Y285 | Phosphorylation | Uniprot | |
R286 | Methylation | Uniprot | |
S291 | Phosphorylation | Uniprot | |
Y365 | Phosphorylation | Uniprot | |
T518 | Phosphorylation | Uniprot | |
S520 | Phosphorylation | Uniprot | |
S521 | Phosphorylation | Uniprot | |
S523 | Phosphorylation | Uniprot | |
S527 | Phosphorylation | Uniprot | |
Y528 | Phosphorylation | Uniprot | |
S539 | Phosphorylation | Uniprot | |
Y548 | Phosphorylation | Uniprot | |
S555 | Phosphorylation | Uniprot | |
Y558 | Phosphorylation | Uniprot | |
S560 | Phosphorylation | Uniprot | |
S562 | Phosphorylation | Uniprot | |
S571 | Phosphorylation | Uniprot | |
T572 | Phosphorylation | Uniprot | |
Y576 | Phosphorylation | Uniprot | |
T579 | Phosphorylation | Uniprot | |
S582 | Phosphorylation | Uniprot | |
S587 | Phosphorylation | Uniprot | |
Y588 | Phosphorylation | Uniprot | |
Y592 | Phosphorylation | Uniprot | |
K593 | Acetylation | Uniprot | |
K593 | Ubiquitination | Uniprot | |
K594 | Sumoylation | Uniprot | |
K594 | Ubiquitination | Uniprot | |
K600 | Sumoylation | Uniprot | |
K600 | Ubiquitination | Uniprot | |
S612 | Phosphorylation | Uniprot | |
Y614 | Phosphorylation | Uniprot | |
R615 | Methylation | Uniprot | |
S618 | Phosphorylation | O14757 (CHEK1) | Uniprot |
S620 | Phosphorylation | Uniprot | |
S623 | Phosphorylation | Uniprot | |
S627 | Phosphorylation | O14757 (CHEK1) | Uniprot |
T629 | Phosphorylation | O14757 (CHEK1) | Uniprot |
S631 | Phosphorylation | Uniprot | |
S632 | Phosphorylation | Uniprot | |
Y635 | Phosphorylation | Uniprot | |
S643 | Phosphorylation | Uniprot | |
Y645 | Phosphorylation | Uniprot | |
R647 | Methylation | Uniprot | |
Y648 | Phosphorylation | Uniprot | |
S649 | Phosphorylation | Q96GD4 (AURKB) | Uniprot |
S651 | Phosphorylation | Uniprot | |
Y652 | Phosphorylation | Uniprot | |
Y655 | Phosphorylation | Uniprot | |
R657 | Methylation | Uniprot | |
Y665 | Phosphorylation | Uniprot |
Research Backgrounds
Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1. Regulates centriole biogenesis by suppressing the formation of aberrant centriolar protein complexes in the cytoplasm and thus preserving mitotic spindle integrity. Prevents the formation of the STIL-CENPJ complex (which can induce the formation of aberrant centriolar protein complexes) by interfering with the interaction of STIL with CENPJ. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Nucleus. Nucleus>Nucleolus. Cytoplasm.
Note: In punctate subnuclear structures often located adjacent to splicing speckles, called paraspeckles (PubMed:11790299). Cytoplasmic localization is crucial for its function in suppressing the formation of aberrant centriolar protein complexes (PubMed:25385835).
Expressed in all tissues tested, including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes.
Isoform 1: Interacts with NCOA6, CITED1 and XRCC5/KU86. Isoform 1: Interacts with SS18 isoform 1. Isoform 1: Interacts with SS18 isoform 2. Interacts with STIL and interferes with its interaction with CENPJ. Interacts with gamma-tubulin.Part of the HDP-RNP complex composed of at least HEXIM1, PRKDC, XRCC5, XRCC6, paraspeckle proteins (SFPQ, NONO, PSPC1, RBM14, and MATR3) and NEAT1 RNA.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.