Hhip Antibody - #DF13634
Product: | Hhip Antibody |
Catalog: | DF13634 |
Description: | Rabbit polyclonal antibody to Hhip |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 78kDa; 79kD(Calculated). |
Uniprot: | Q96QV1 |
RRID: | AB_2846653 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13634, RRID:AB_2846653.
Fold/Unfold
FLJ20992; FLJ90230; Hedgehog interacting protein; Hedgehog-interacting protein; hedgehoginteracting protein; HHIP; HHIP_HUMAN; Hip;
Immunogens
Widely expressed in fetal and adult tissues. Highest expression in adult heart, liver and pancreas, and in fetal kidney.
- Q96QV1 HHIP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96QV1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K93 | Ubiquitination | Uniprot | |
K105 | Ubiquitination | Uniprot | |
K174 | Ubiquitination | Uniprot | |
K247 | Ubiquitination | Uniprot | |
K252 | Ubiquitination | Uniprot | |
K262 | Ubiquitination | Uniprot | |
K270 | Ubiquitination | Uniprot | |
K277 | Ubiquitination | Uniprot | |
Y293 | Phosphorylation | Uniprot | |
K329 | Ubiquitination | Uniprot | |
N447 | N-Glycosylation | Uniprot | |
K472 | Ubiquitination | Uniprot | |
K533 | Ubiquitination | Uniprot | |
Y616 | Phosphorylation | Uniprot | |
T618 | Phosphorylation | Uniprot | |
T620 | Phosphorylation | Uniprot | |
K622 | Ubiquitination | Uniprot | |
S626 | Phosphorylation | Uniprot | |
K659 | Ubiquitination | Uniprot |
Research Backgrounds
Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family.
Cell membrane>Peripheral membrane protein. Secreted.
Note: The last 22 C-terminal amino acids may participate in cell membrane attachment.
Cytoplasm.
Widely expressed in fetal and adult tissues. Highest expression in adult heart, liver and pancreas, and in fetal kidney.
Interacts with all three hedgehog family members, SHH, IHH and DHH.
A flexible loop interacts with the SHH zinc binding site and contributes to zinc binding.
Belongs to the HHIP family.
Research Fields
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hedgehog signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Basal cell carcinoma. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.