IRF8 Antibody - #DF13627
Product: | IRF8 Antibody |
Catalog: | DF13627 |
Description: | Rabbit polyclonal antibody to IRF8 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Horse, Rabbit, Dog |
Mol.Wt.: | 48kDa; 48kD(Calculated). |
Uniprot: | Q02556 |
RRID: | AB_2846646 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13627, RRID:AB_2846646.
Fold/Unfold
H ICSBP; H-ICSBP; HGNC:5358; HICSBP; ICSBP 1; ICSBP; ICSBP1; Interferon consensus sequence binding protein 1; Interferon consensus sequence binding protein; Interferon consensus sequence-binding protein; Interferon regulatory factor 8; IRF 8; IRF-8; Irf8; IRF8_HUMAN; MYLS;
Immunogens
- Q02556 IRF8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q02556 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y107 | Phosphorylation | Uniprot | |
Y110 | Phosphorylation | Uniprot | |
S162 | Phosphorylation | Uniprot | |
S164 | Phosphorylation | Uniprot | |
Y211 | Phosphorylation | Uniprot | |
K240 | Ubiquitination | Uniprot | |
K269 | Methylation | Uniprot | |
Y373 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role as a transcriptional activator or repressor. Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes (By similarity). Positively regulates macroautophagy in dendritic cells.
Ubiquitinated. Ubiquitination by TRIM21 in macrophages, a process that is strongly increased upon interferon gamma stimulation, leds to the enhanced transcriptional activity of target cytokine genes (By similarity). Ubiquitination leads to its degradation by the proteasome.
Sumoylated with SUMO3. Desumoylated by SENP1.
Nucleus. Cytoplasm.
Note: In resting macrophages, localizes in the cytoplasm. Translocated in the nucleus upon IFN-gamma induction.
Predominantly expressed in lymphoid tissues.
Interacts (via C-terminus) with TRIM21 (via C-terminus). Interacts with the BATF-JUNB heterodimer. Interacts with BATF (via bZIP domain); the interaction is direct (By similarity). Interacts with COPS2.
Belongs to the IRF family.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.