Lefty Antibody - #DF13617
Product: | Lefty Antibody |
Catalog: | DF13617 |
Description: | Rabbit polyclonal antibody to Lefty |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 40kDa; 41kD(Calculated). |
Uniprot: | O75610 |
RRID: | AB_2846636 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13617, RRID:AB_2846636.
Fold/Unfold
AI450052; Ebaf; Left right determination factor 1; Left right determination factor; Left right determination factor B; left-right determination factor; LEFT-RIGHT DETERMINATION FACTOR 1; LEFTY1; left-right determination, factor B; LEFT-RIGHT DETERMINATION, FACTOR B; LEFTY B; LEFTB; LEFTY 1; Lefty; lefty-1; LEFTY1; LEFTY1, MOUSE, HOMOLOG OF; LEFTYB; OTTHUMP00000035572; Protein lefty-1; Protein lefty-B; RGD1561867; Stimulated by retinoic acid gene 3 protein; STRA3; TGF beta 4; TGF-beta-4; Tgfb4; Transforming growth factor beta 4; Transforming growth factor beta-4;
Immunogens
- O75610 LFTY1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
PTMs - O75610 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S79 | Phosphorylation | Uniprot | |
S81 | Phosphorylation | Uniprot |
Research Backgrounds
Required for left-right axis determination as a regulator of LEFTY2 and NODAL.
The processing of the protein may also occur at the second R-X-X-R site located at AA 132-135. Processing appears to be regulated in a cell-type specific manner.
Secreted.
Belongs to the TGF-beta family.
Research Fields
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.