Amino-terminal enhancer of split Antibody - #DF13613
Product: | Amino-terminal enhancer of split Antibody |
Catalog: | DF13613 |
Description: | Rabbit polyclonal antibody to Amino-terminal enhancer of split |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Xenopus |
Mol.Wt.: | 21kDa; 22kD(Calculated). |
Uniprot: | Q08117 |
RRID: | AB_2846632 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13613, RRID:AB_2846632.
Fold/Unfold
Aes 1; Aes 2; aes; AES_HUMAN; Aes1; Aes2; Amino enhancer of split; Amino terminal enhancer of split; Amino-terminal enhancer of split; Esp 1; Esp1; Gp130 associated protein GAM; Gp130-associated protein GAM; GRG 5; GRG; GRG protein; Grg-5; GRG5; Groucho-related protein 5; Protein ESP 1; Protein ESP1; Protein GRG; TLE 5; TLE5;
Immunogens
Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.
- Q08117 TLE5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q08117 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
R7 | Methylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
S11 | Phosphorylation | Uniprot | |
K19 | Ubiquitination | Uniprot | |
S25 | Phosphorylation | Uniprot | |
K30 | Ubiquitination | Uniprot | |
K44 | Ubiquitination | Uniprot | |
K49 | Ubiquitination | Uniprot | |
K54 | Ubiquitination | Uniprot | |
Y69 | Phosphorylation | Uniprot | |
K83 | Ubiquitination | Uniprot | |
K112 | Ubiquitination | Uniprot | |
T143 | Phosphorylation | Uniprot | |
S196 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional corepressor. Acts as dominant repressor towards other family members. Inhibits NF-kappa-B-regulated gene expression. May be required for the initiation and maintenance of the differentiated state. Essential for the transcriptional repressor activity of SIX3 during retina and lens development.
Ubiquitinated by XIAP/BIRC4.
Nucleus.
Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.
Homooligomer and heterooligomer with other family members. Binds TCF7 (By similarity). Binds the NF-kappa-B subunit RELA. Interacts with PHF12. Interacts (via Q domain) with SIX3. Interacts with SIX6.
Lacks the C-terminal WD repeats.
Belongs to the WD repeat Groucho/TLE family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.