Surfactant protein D Antibody - #DF13601
Product: | Surfactant protein D Antibody |
Catalog: | DF13601 |
Description: | Rabbit polyclonal antibody to Surfactant protein D |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 38kDa; 38kD(Calculated). |
Uniprot: | P35247 |
RRID: | AB_2846620 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13601, RRID:AB_2846620.
Fold/Unfold
COLEC 7; COLEC7; Collectin-7; Collectin7; Lung surfactant protein D; PSP D; PSP-D; PSP-D Surfactant protein D; PSPD; Pulmonary surfactant apoprotein; Pulmonary surfactant associated protein D; Pulmonary surfactant associated protein PSP-D; Pulmonary surfactant-associated protein D; SFTP 4; SFTP4; SFTPD; SFTPD_HUMAN; SP D; SP-D; Surfactant associated protein pulmonary 4; Surfactant protein D; Surfactant pulmonary associated protein D;
Immunogens
Expressed in lung, brain, pancreas and adipose tissue (mainly mature adipocytes).
- P35247 SFTPD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P35247 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T30 | Phosphorylation | Uniprot | |
S33 | Phosphorylation | Uniprot | |
C35 | S-Nitrosylation | Uniprot | |
C40 | S-Nitrosylation | Uniprot |
Research Backgrounds
Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
The N-terminus is blocked.
Hydroxylation on proline residues within the sequence motif, GXPG, is most likely to be 4-hydroxy as this fits the requirement for 4-hydroxylation in vertebrates.
S-nitrosylation at Cys-35 and Cys-40 alters the quaternary structure which results in a pro-inflammatory chemoattractive signaling activity with macrophages.
Secreted>Extracellular space>Extracellular matrix. Secreted>Extracellular space>Surface film.
Expressed in lung, brain, pancreas and adipose tissue (mainly mature adipocytes).
Oligomeric complex of 4 set of homotrimers.
Belongs to the SFTPD family.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
References
Application: WB Species: Mouse Sample: lung tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.