KIR2DL4 Antibody - #DF13591
| Product: | KIR2DL4 Antibody |
| Catalog: | DF13591 |
| Description: | Rabbit polyclonal antibody to KIR2DL4 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 41kDa,28kDa; 41kD(Calculated). |
| Uniprot: | Q99706 |
| RRID: | AB_2846610 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13591, RRID:AB_2846610.
Fold/Unfold
CD_antigen=CD158d; CD158 antigen like family member D; CD158 antigen-like family member D; CD158d; G9P; KI2L4_HUMAN; Killer cell immunoglobulin like receptor 2DL4; Killer cell immunoglobulin like receptor, two domains, long cytoplasmic tail, 4; Killer cell immunoglobulin-like receptor 2DL4; Killer cell inhibitory receptor 103AS; Killer Ig receptor; KIR 103AS; KIR-103AS; KIR103; KIR103AS; KIR2DL4; MHC class I NK cell receptor KIR103AS; Natural killer cell inhibitory receptor; NK cell receptor; NK cell receptor; natural killer cell inhibitory receptor; OTTHUMP00000068612; OTTHUMP00000068614; OTTHUMP00000068615;
Immunogens
Expressed in decidual NK cells and innate lymphoid cell type I (ILC1) (PubMed:29262349). Expressed in a subset of peripheral NK cells (PubMed:19304799).
- Q99706 KI2L4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHRWCSKKKDAAVMNQEPAGHRTVNREDSDEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETTALSQTQLASSNVPAAGI
PTMs - Q99706 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y74 | Phosphorylation | Uniprot | |
| T120 | Phosphorylation | Uniprot | |
| Y123 | Phosphorylation | Uniprot | |
| S355 | Phosphorylation | Uniprot | |
| S356 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for non-classical major histocompatibility class Ib HLA-G molecules. Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide (peptide-bound HLA-G-B2M). In decidual NK cells, binds peptide-bound HLA-G-B2M complex and triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy. May play a role in balancing tolerance and antiviral-immunity at maternal-fetal interface by keeping in check the effector functions of NK, CD8+ T cells and B cells. Upon interaction with peptide-bound HLA-G-B2M, initiates signaling from the endosomal compartment leading to downstream activation of PRKDC-XRCC5 and AKT1, and ultimately triggering NF-kappa-B-dependent proinflammatory response.
Cell membrane>Single-pass type I membrane protein. Early endosome membrane.
Expressed in decidual NK cells and innate lymphoid cell type I (ILC1). Expressed in a subset of peripheral NK cells.
Interacts with peptide-bound HLA-G-B2M heterotrimeric complex. Interacts with ARRB2.
Belongs to the immunoglobulin superfamily.
Research Fields
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.