BASP1 Antibody - #DF13578
Product: | BASP1 Antibody |
Catalog: | DF13578 |
Description: | Rabbit polyclonal antibody to BASP1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish |
Mol.Wt.: | 22kDa; 23kD(Calculated). |
Uniprot: | P80723 |
RRID: | AB_2846597 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13578, RRID:AB_2846597.
Fold/Unfold
22 kDa neuronal tissue enriched acidic protein; BASP 1; BASP1 protein; Brain abundant membrane attached signal protein 1; Brain Abundant Signal Protein Membrane Attached 1; Brain Acid Soluble Protein 1; CAP 23; CAP23; MGC8555; NAP 22; NAP22; Neuronal axonal membrane protein NAP 22; Neuronal tissue enriched acidic protein;
Immunogens
- P80723 BASP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P80723 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
G2 | Myristoylation | Uniprot | |
K10 | Ubiquitination | Uniprot | |
Y12 | Phosphorylation | Uniprot | |
K18 | Ubiquitination | Uniprot | |
K25 | Ubiquitination | Uniprot | |
T31 | Phosphorylation | Uniprot | |
T36 | Phosphorylation | Uniprot | |
K38 | Ubiquitination | Uniprot | |
S40 | Phosphorylation | Uniprot | |
K52 | Ubiquitination | Uniprot | |
K55 | Ubiquitination | Uniprot | |
K57 | Ubiquitination | Uniprot | |
K65 | Ubiquitination | Uniprot | |
K73 | Ubiquitination | Uniprot | |
K79 | Ubiquitination | Uniprot | |
K84 | Ubiquitination | Uniprot | |
K89 | Ubiquitination | Uniprot | |
K97 | Acetylation | Uniprot | |
K97 | Ubiquitination | Uniprot | |
K102 | Ubiquitination | Uniprot | |
K121 | Ubiquitination | Uniprot | |
S132 | Phosphorylation | Uniprot | |
S142 | Phosphorylation | Uniprot | |
K143 | Sumoylation | Uniprot | |
K143 | Ubiquitination | Uniprot | |
K150 | Ubiquitination | Uniprot | |
T162 | Phosphorylation | Uniprot | |
K163 | Sumoylation | Uniprot | |
K163 | Ubiquitination | Uniprot | |
S164 | Phosphorylation | Uniprot | |
S170 | Phosphorylation | Uniprot | |
S172 | Phosphorylation | Uniprot | |
K173 | Ubiquitination | Uniprot | |
S176 | Phosphorylation | Uniprot | |
S177 | Phosphorylation | Uniprot | |
S182 | Phosphorylation | Uniprot | |
S183 | Phosphorylation | Uniprot | |
K184 | Ubiquitination | Uniprot | |
T186 | Phosphorylation | Uniprot | |
T190 | Phosphorylation | Uniprot | |
S194 | Phosphorylation | Uniprot | |
S195 | Phosphorylation | Uniprot | |
T196 | Phosphorylation | Uniprot | |
K198 | Ubiquitination | Uniprot | |
S205 | Phosphorylation | Uniprot | |
K210 | Acetylation | Uniprot | |
K210 | Ubiquitination | Uniprot | |
S219 | Phosphorylation | Uniprot | |
K226 | Ubiquitination | Uniprot |
Research Backgrounds
Cell membrane>Lipid-anchor. Cell projection>Growth cone.
Note: Associated with the membranes of growth cones that form the tips of elongating axons.
Brain.
Belongs to the BASP1 family.
References
Application: WB Species: Human Sample: lung adenocarcinoma cell
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.