Product: PITX2 Antibody
Catalog: DF13574
Description: Rabbit polyclonal antibody to PITX2
Application: WB IHC
Cited expt.:
Reactivity: Human, Mouse, Rat
Mol.Wt.: 35kDa; 35kD(Calculated).
Uniprot: Q99697
RRID: AB_2846593

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
PITX2 Antibody detects endogenous levels of total PITX2.
RRID:
AB_2846593
Cite Format: Affinity Biosciences Cat# DF13574, RRID:AB_2846593.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Immunogens

Immunogen:

A synthesized peptide derived from human PITX2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV

Research Backgrounds

Function:

Controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, exerts a role in the expansion of muscle progenitors. May play a role in the proper localization of asymmetric organs such as the heart and stomach. Isoform PTX2C is involved in left-right asymmetry the developing embryo (By similarity).

PTMs:

Phosphorylation at Thr-90 impairs its association with the CCND1 mRNA-stabilizing complex thus shortening the half-life of CCND1.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the paired homeobox family. Bicoid subfamily.

Research Fields

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

References

1). PITX2 functions as a transcription factor for GPX4 and protects pancreatic cancer cells from ferroptosis. Experimental cell research, 2024 (PubMed: 38710403) [IF=3.3]

2). Weighted Correlation Network Analysis of Cancer Stem Cell-Related Prognostic Biomarkers in Esophageal Squamous Cell Carcinoma. Technology in Cancer Research & Treatment, 2022 (PubMed: 35899307) [IF=2.7]

Application: IF/ICC    Species: Human    Sample: esophageal squamous cell carcinoma (ESCC)

Figure 3. Representative immunofluorescence of CILP (red), CST1 (red), DPP4 (red), F2RL2 (green), PITX2 (green), RIOX (red), ZFHX4 (green) in esophageal squamous cell carcinoma (ESCC) samples and normal tissues of 112 ESCC patients from Zhongshan Hospital, Fudan University.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.