NAPE-PLD Antibody - #DF13571
| Product: | NAPE-PLD Antibody |
| Catalog: | DF13571 |
| Description: | Rabbit polyclonal antibody to NAPE-PLD |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Pig, Bovine, Horse, Rabbit |
| Mol.Wt.: | 45kDa; 46kD(Calculated). |
| Uniprot: | Q6IQ20 |
| RRID: | AB_2846590 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13571, RRID:AB_2846590.
Fold/Unfold
C7orf18; DKFZp781D1098; FMP30; Mbldc1; N acyl phosphatidylethanolamine hydrolyzing phospholipase D; N acyl phosphatidylethanolamine phospholipase D; N-acyl phosphatidylethanolamine phospholipase D; N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D; NAPE hydrolyzing phospholipase D; NAPE-hydrolyzing phospholipase D; NAPE-PLD; NAPEP_HUMAN; NAPEPLD;
Immunogens
Widely expressed. Highest expression in brain, kidney and testis (at protein level). Expressed in adipose tissue (at protein level).
- Q6IQ20 NAPEP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q6IQ20 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| S43 | Phosphorylation | Uniprot | |
| K59 | Methylation | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| K97 | Ubiquitination | Uniprot | |
| K102 | Ubiquitination | Uniprot | |
| K296 | Ubiquitination | Uniprot |
Research Backgrounds
Hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. Responsible for the generation of these bioactive fatty acid ethanolamides (FAEs), including anandamide (N-arachidonoylethanolamine), the ligand of cannabinoid and vanilloid receptors. As a regulator of lipid metabolism in the adipose tissue, mediates the crosstalk between adipocytes, gut microbiota and immune cells to control body temperature and weight. In particular, regulates energy homeostasis by promoting cold-induced brown or beige adipocyte differentiation program to generate heat from fatty acids and glucose (By similarity).
Golgi apparatus membrane>Peripheral membrane protein. Early endosome membrane>Peripheral membrane protein. Nucleus envelope. Nucleus>Nucleoplasm.
Note: Localized in the proximity of the cellular membranes likely through interaction with membrane phospholipids.
Widely expressed. Highest expression in brain, kidney and testis (at protein level). Expressed in adipose tissue (at protein level).
Homodimer. Bile acids promote the assembly of inactive monomers into an active dimer and enable catalysis.
Belongs to the NAPE-PLD family.
Research Fields
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.