URP2 Antibody - #DF13558
| Product: | URP2 Antibody |
| Catalog: | DF13558 |
| Description: | Rabbit polyclonal antibody to URP2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 75kDa; 76kD(Calculated). |
| Uniprot: | Q86UX7 |
| RRID: | AB_2846577 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13558, RRID:AB_2846577.
Fold/Unfold
Fermitin family homolog 3; Fermitin family member 3; FERMT3; Kind3; Kindlin 3; Kindlin-3; Kindlin3; MGC10966; MIG 2; MIG2 like protein; MIG2-like protein; MIG2B; Unc 112 related protein 2; Unc-112-related protein 2; UNC112C; URP2; URP2_HUMAN; URP2SF;
Immunogens
Highly expressed in lymph node. Expressed in thymus, spleen and leukocytes. Weakly expressed in placenta, small intestine, stomach, testis and lung. Overexpressed in B-cell malignancies.
- Q86UX7 URP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFRIPRRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q86UX7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K5 | Ubiquitination | Uniprot | |
| T6 | Phosphorylation | Uniprot | |
| S8 | Phosphorylation | Uniprot | |
| Y11 | Phosphorylation | Uniprot | |
| S14 | Phosphorylation | Uniprot | |
| S31 | Phosphorylation | Uniprot | |
| K56 | Ubiquitination | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K155 | Ubiquitination | Uniprot | |
| Y162 | Phosphorylation | Uniprot | |
| K166 | Ubiquitination | Uniprot | |
| S218 | Phosphorylation | Uniprot | |
| K222 | Ubiquitination | Uniprot | |
| K242 | Ubiquitination | Uniprot | |
| K252 | Ubiquitination | Uniprot | |
| S337 | Phosphorylation | Uniprot | |
| S345 | Phosphorylation | Uniprot | |
| K353 | Ubiquitination | Uniprot | |
| T369 | Phosphorylation | Uniprot | |
| K371 | Methylation | Uniprot | |
| K371 | Ubiquitination | Uniprot | |
| K389 | Ubiquitination | Uniprot | |
| K405 | Ubiquitination | Uniprot | |
| K419 | Acetylation | Uniprot | |
| K419 | Ubiquitination | Uniprot | |
| S428 | Phosphorylation | Uniprot | |
| T482 | Phosphorylation | Uniprot | |
| S484 | Phosphorylation | Uniprot | |
| Y504 | Phosphorylation | Uniprot | |
| K516 | Methylation | Uniprot | |
| K567 | Ubiquitination | Uniprot | |
| K590 | Ubiquitination | Uniprot | |
| T591 | Phosphorylation | Uniprot | |
| S595 | Phosphorylation | Uniprot | |
| S622 | Phosphorylation | Uniprot | |
| S625 | Phosphorylation | Uniprot | |
| S642 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a central role in cell adhesion in hematopoietic cells. Acts by activating the integrin beta-1-3 (ITGB1, ITGB2 and ITGB3) (By similarity). Required for integrin-mediated platelet adhesion and leukocyte adhesion to endothelial cells. Required for activation of integrin beta-2 (ITGB2) in polymorphonuclear granulocytes (PMNs) (By similarity).
Isoform 2 may act as a repressor of NF-kappa-B and apoptosis.
Cell projection>Podosome.
Note: Present in the F-actin surrounding ring structure of podosomes, which are specialized adhesion structures of hematopoietic cells.
Highly expressed in lymph node. Expressed in thymus, spleen and leukocytes. Weakly expressed in placenta, small intestine, stomach, testis and lung. Overexpressed in B-cell malignancies.
Interacts with ITGB1, ITGB2 and ITGB3 (via cytoplasmic tails).
The FERM domain is not correctly detected by PROSITE or Pfam techniques because it contains the insertion of a PH domain.
Belongs to the kindlin family.
Research Fields
· Organismal Systems > Immune system > Platelet activation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.