RBCK1 Antibody - #DF13544
| Product: | RBCK1 Antibody |
| Catalog: | DF13544 |
| Description: | Rabbit polyclonal antibody to RBCK1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 57kDa; 58kD(Calculated). |
| Uniprot: | Q9BYM8 |
| RRID: | AB_2846563 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13544, RRID:AB_2846563.
Fold/Unfold
C20orf18; Chromosome 20 open reading frame 18; HBV associated factor 4; HBV-associated factor 4; Heme-oxidized IRP2 ubiquitin ligase 1; Hepatitis B virus X associated protein 4; Hepatitis B virus X-associated protein 4; HOIL 1L; HOIL-1; HOIL-1L; HOIL1; HOIL1L; RanBP type and C3HC4 type zinc finger containing 1; RanBP-type and C3HC4-type zinc finger-containing protein 1; RBCC protein interacting with PKC1; Rbck1; RBCK2; RING finger protein 54; RNF54; UB7I3_HUMAN; UBCE7IP3; Ubiquitin conjugating enzyme 7 interacting protein 3; Ubiquitin-conjugating enzyme 7-interacting protein 3; XAP3; XAP4; ZRANB4;
Immunogens
- Q9BYM8 HOIL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BYM8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| K29 | Ubiquitination | Uniprot | |
| S50 | Phosphorylation | Uniprot | |
| K158 | Ubiquitination | Uniprot | |
| K174 | Ubiquitination | Uniprot | |
| S229 | Phosphorylation | Uniprot | |
| K254 | Ubiquitination | Uniprot | |
| Y262 | Phosphorylation | Uniprot | |
| S272 | Phosphorylation | Uniprot | |
| S322 | Phosphorylation | Uniprot | |
| Y330 | Phosphorylation | Uniprot | |
| S331 | Phosphorylation | Uniprot | |
| S333 | Phosphorylation | Uniprot | |
| K335 | Ubiquitination | Uniprot | |
| K342 | Ubiquitination | Uniprot | |
| T346 | Phosphorylation | Uniprot | |
| S368 | Phosphorylation | Uniprot | |
| K412 | Ubiquitination | Uniprot | |
| K436 | Ubiquitination | Uniprot | |
| S490 | Phosphorylation | Uniprot |
Research Backgrounds
E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates. Functions as an E3 ligase for oxidized IREB2 and both heme and oxygen are necessary for IREB2 ubiquitination. Promotes ubiquitination of TAB2 and IRF3 and their degradation by the proteasome. Component of the LUBAC complex which conjugates linear ('Met-1'-linked) polyubiquitin chains to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Together with OTULIN, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis. Binds polyubiquitin of different linkage types.
Auto-ubiquitinated. Auto-ubiquitination leads to degradation by the proteasome (By similarity).
Phosphorylated. In vitro, phosphorylation inhibits auto-ubiquitination activity (By similarity).
Component of the LUBAC complex (linear ubiquitin chain assembly complex) which consists of SHARPIN, RBCK1 and RNF31. LUBAC has a MW of approximately 600 kDa suggesting a heteromultimeric assembly of its subunits. Interacts with beta-I-type (PRKCB1) and zeta-type protein kinase C (PRKCZ) and with UBE2L3. Interacts with PRKCH. Isoform 1 and isoform 2 interact with IREB2 only in iron-rich conditions. Associates with the TNF-R1 signaling complex (TNF-RSC) in a stimulation-dependent manner. Interacts with EYA1, TAB2, TAB3, MAP3K7 TRAF6 and RIPK1. Interacts with IRF3.
(Microbial infection) Interacts with hepatitis B virus/HBV protein HBx; this interaction is required to activate transcription of the viral genome.
The RanBP2-type zinc finger, also called Npl4 zinc finger (NZF), mediates binding to 'Met-1'-linked polyubiquitins.
The UBL domain mediates association with RNF31 via interaction with its UBA domain.
Belongs to the RBR family.
Research Fields
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.