BIN1 Antibody - #DF13520
Product: | BIN1 Antibody |
Catalog: | DF13520 |
Description: | Rabbit polyclonal antibody to BIN1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Horse, Rabbit, Dog |
Mol.Wt.: | 64kDa; 65kD(Calculated). |
Uniprot: | O00499 |
RRID: | AB_2846539 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13520, RRID:AB_2846539.
Fold/Unfold
AMPH 2; AMPH2; Amphiphysin 2; Amphiphysin II; Amphiphysin like protein; amphiphysin-like; Amphiphysin-like protein; AMPHL; Bin1; BIN1_HUMAN; Box Dependant MYC Interacting Protein 1; Box-dependent myc-interacting protein 1; Bridging integrator 1; DKFZp547F068; MGC10367; MGC105358; Myc box dependent interacting protein 1; Myc box-dependent-interacting protein 1; SH3P9;
Immunogens
Ubiquitous. Highest expression in the brain and muscle (PubMed:9182667). Expressed in oligodendrocytes (PubMed:27488240). Isoform IIA is expressed only in the brain, where it is detected in the gray matter, but not in the white matter (PubMed:27488240). Isoform BIN1 is widely expressed with highest expression in skeletal muscle.
- O00499 BIN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00499 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
K28 | Acetylation | Uniprot | |
K40 | Ubiquitination | Uniprot | |
K53 | Ubiquitination | Uniprot | |
R66 | Methylation | Uniprot | |
S71 | Phosphorylation | Uniprot | |
S79 | Phosphorylation | Uniprot | |
K146 | Ubiquitination | Uniprot | |
Y150 | Phosphorylation | Uniprot | |
S152 | Phosphorylation | Uniprot | |
K164 | Ubiquitination | Uniprot | |
K258 | Ubiquitination | Uniprot | |
K272 | Ubiquitination | Uniprot | |
S276 | Phosphorylation | Uniprot | |
K282 | Ubiquitination | Uniprot | |
S296 | Phosphorylation | Uniprot | |
S298 | Phosphorylation | Uniprot | |
S303 | Phosphorylation | Uniprot | |
T307 | Phosphorylation | Uniprot | |
T323 | Phosphorylation | Uniprot | |
T327 | Phosphorylation | Uniprot | |
S331 | Phosphorylation | Uniprot | |
S333 | Phosphorylation | Uniprot | |
T348 | Phosphorylation | Uniprot | |
S488 | Phosphorylation | Uniprot | |
S489 | Phosphorylation | Uniprot | |
T534 | Phosphorylation | Uniprot |
Research Backgrounds
Is a key player in the control of plasma membrane curvature, membrane shaping and membrane remodeling. Required in muscle cells for the formation of T-tubules, tubular invaginations of the plasma membrane that function in depolarization-contraction coupling. Is a negative regulator of endocytosis (By similarity). Is also involved in the regulation of intracellular vesicles sorting, modulation of BACE1 trafficking and the control of amyloid-beta production. In neuronal circuits, endocytosis regulation may influence the internalization of PHF-tau aggregates (By similarity). May be involved in the regulation of MYC activity and the control cell proliferation. Has actin bundling activity and stabilizes actin filaments against depolymerization in vitro.
Phosphorylated by protein kinase C.
Nucleus. Cytoplasm. Endosome. Cell membrane>Sarcolemma>T-tubule.
Cytoplasm.
Ubiquitous. Highest expression in the brain and muscle. Expressed in oligodendrocytes. Isoform IIA is expressed only in the brain, where it is detected in the gray matter, but not in the white matter. Isoform BIN1 is widely expressed with highest expression in skeletal muscle.
Heterodimer with AMPH (By similarity). Binds SH3GLB1 (By similarity). Interacts (via SH3 domain) with DNM1. Interacts with SYNJ1 (By similarity). Interacts (via SH3 domain) with DNM2. Isoform IIA interacts with CLTC. Isoform IIB does not interact with CLTC. Isoform IIC1 does not interact with CLTC. Isoform IIC2 does not interact with CLTC. Interacts with AP2A2. Interacts with AP2B1 (By similarity). Interacts with MYC (via N-terminal transactivation domain); the interaction requires the integrity of the conserved MYC box regions 1 and 2 (By similarity). Interacts with BIN2. Interacts with SNX4. Interacts (via BAR domain) with BACE1. Binds (via BAR domain) F-actin.
(Microbial infection) Interacts (SH3 domain) with HCV NS5A.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.