HSP20 Antibody - #AF6003
| Product: | HSP20 Antibody |
| Catalog: | AF6003 |
| Description: | Rabbit polyclonal antibody to HSP20 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB, IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 18kDa; 17kD(Calculated). |
| Uniprot: | O14558 |
| RRID: | AB_2834938 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6003, RRID:AB_2834938.
Fold/Unfold
epididymis luminal protein 55; FLJ32389; Heat shock 20 kDa like protein p20; Heat shock 20 kDa-like protein p20; Heat shock protein alpha crystallin related B6; Heat shock protein beta 6; Heat shock protein beta-6; Heat shock protein, 20-KD; Heat-shock 27-KD protein 6; HEL55; Hsp20; HspB6; HSPB6_HUMAN;
Immunogens
A synthesized peptide derived from human HSP20, corresponding to a region within N-terminal amino acids.
- O14558 HSPB6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function such as smooth muscle vasorelaxation and cardiac myocyte contractility. May regulate myocardial angiogenesis implicating KDR. Overexpression mediates cardioprotection and angiogenesis after induced damage. Stabilizes monomeric YWHAZ thereby supporting YWHAZ chaperone-like activity.
The N-terminus is blocked.
Phosphorylated at Ser-16 by PKA and probably PKD1K; required to protect cardiomyocytes from apoptosis.
Cytoplasm. Nucleus. Secreted.
Note: Translocates to nuclear foci during heat shock.
Belongs to the small heat shock protein (HSP20) family.
References
Application: WB Species: Human Sample: MDA-MB-468 cell
Application: IHC Species: Human Sample: MDA-MB-468 cell
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.