PR3 Antibody - #DF13410
| Product: | PR3 Antibody |
| Catalog: | DF13410 |
| Description: | Rabbit polyclonal antibody to PR3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 27kDa; 28kD(Calculated). |
| Uniprot: | P24158 |
| RRID: | AB_2846429 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13410, RRID:AB_2846429.
Fold/Unfold
ACPA; AGP 7; AGP7; AGP7 serine proteinase; Azurophil Granule Protein 7; C ANCA; C ANCA antigen; C-ANCA antigen; CANCA; EC 3.4.21.76; Leukocyte proteinase 3; MBN; MBT; MBT WEGENER AUTOANTIGEN; Myeloblastin; Neutrophil proteinase 4; NP 4; NP-4; NP4; P29; PR 3; PR-3; PR3; Proteinase 3; Proteinase3; PRTN 3; Prtn3; PRTN3_HUMAN; Serine proteinase neutrophil Wegener granulomatosis autoantigen; Serine proteinase, neutrophil; Wegener autoantigen; Wegener granulomatosis autoantigen;
Immunogens
Expressed in polymorphonuclear leukocytes (at protein level) (PubMed:2033050, PubMed:7897245, PubMed:3198760). Expressed in neutrophils (at protein level) (PubMed:28240246, PubMed:18462208, PubMed:21193407, PubMed:22266279, PubMed:17244676). Expressed in differentiating neutrophils (PubMed:18462208).
- P24158 PRTN3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP
PTMs - P24158 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| N174 | N-Glycosylation | Uniprot |
Research Backgrounds
Serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro). By cleaving and activating receptor F2RL1/PAR-2, enhances endothelial cell barrier function and thus vascular integrity during neutrophil transendothelial migration. May play a role in neutrophil transendothelial migration, probably when associated with CD177.
Cytoplasmic granule. Secreted. Cell membrane>Peripheral membrane protein>Extracellular side. Membrane raft>Peripheral membrane protein>Extracellular side.
Note: Localizes predominantly to azurophil granules (primary secretory granules) in neutrophils (PubMed:2033050, PubMed:3198760, PubMed:7897245, PubMed:18462208). Secreted upon neutrophil stimulation by TNF-alpha, lipopolysaccharide (LPS), fMLP and CXCL8/IL8 or during neutrophil transmigration (PubMed:22266279, PubMed:28240246). Following secretion tethered to the cell membrane by CD177 (PubMed:18462208, PubMed:22266279).
Expressed in polymorphonuclear leukocytes (at protein level). Expressed in neutrophils (at protein level). Expressed in differentiating neutrophils.
May form dimers. Interacts with CD177; the interaction tethers PRTN3 to the cell surface; the interaction is direct. Interacts with SERPINB1.
Belongs to the peptidase S1 family. Elastase subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.