Statherin Antibody - #DF13407
Product: | Statherin Antibody |
Catalog: | DF13407 |
Description: | Rabbit polyclonal antibody to Statherin |
Application: | WB IHC |
Reactivity: | Human |
Mol.Wt.: | 7kDa; 7kD(Calculated). |
Uniprot: | P02808 |
RRID: | AB_2846426 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13407, RRID:AB_2846426.
Fold/Unfold
STAT_HUMAN; STATH; Statherin; Statherin precursor; STR;
Immunogens
- P02808 STAT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
PTMs - P02808 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S15 | Phosphorylation | Uniprot | |
S21 | Phosphorylation | Uniprot | |
S22 | Phosphorylation | Uniprot | |
Y49 | Phosphorylation | Uniprot |
Research Backgrounds
Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
Substrate for transglutaminase-2. More than 95% of the cyclized peptide is cyclo-statherin Q-37, and less than 5% is cyclo-statherin Q-39. Cyclized forms account for about 1% of total statherin in saliva.
Sulfated on tyrosine residues.
Secreted.
Secreted by parotid and submandibular glands.
Belongs to the histatin/statherin family.
Research Fields
· Organismal Systems > Digestive system > Salivary secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.