Activin Receptor Type IA Antibody - #DF13370
Product: | Activin Receptor Type IA Antibody |
Catalog: | DF13370 |
Description: | Rabbit polyclonal antibody to Activin Receptor Type IA |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 57kDa; 57kD(Calculated). |
Uniprot: | Q04771 |
RRID: | AB_2846389 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13370, RRID:AB_2846389.
Fold/Unfold
Activin A receptor type I; Activin A receptor type II like kinase 2; Activin receptor type I; Activin receptor type-1; Activin receptor-like kinase 2; ACTR-I; ACTRI; Acvr1; ACVR1_HUMAN; ACVR1A; ACVRLK2; ALK 2; ALK-2; ALK2; FOP; Hydroxyalkyl protein kinase; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TGFB superfamily receptor type I; TSR-I; TSRI;
Immunogens
Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells.
- Q04771 ACVR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q04771 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T203 | Phosphorylation | Uniprot | |
S226 | Phosphorylation | Uniprot | |
K340 | Ubiquitination | Uniprot | |
K446 | Ubiquitination | Uniprot | |
K472 | Ubiquitination | Uniprot | |
K475 | Ubiquitination | Uniprot | |
K497 | Ubiquitination | Uniprot | |
S501 | Phosphorylation | Uniprot | |
K504 | Ubiquitination | Uniprot |
PTMs - Q04771 As Enzyme
Research Backgrounds
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis (By similarity).
Membrane>Single-pass type I membrane protein.
Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells.
Interacts with FKBP1A Ref.7). Interacts with FCHO1. Interacts with CLU.
Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.