DGAT1 Antibody - #DF13368
 (5)  
			
			
			(4)
(5)  
			
			
			(4)  
			
			
		| Product: | DGAT1 Antibody | 
| Catalog: | DF13368 | 
| Description: | Rabbit polyclonal antibody to DGAT1 | 
| Application: | WB IHC | 
| Cited expt.: | WB | 
| Reactivity: | Human, Mouse, Rat | 
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Xenopus | 
| Mol.Wt.: | 55kDa; 55kD(Calculated). | 
| Uniprot: | O75907 | 
| RRID: | AB_2846387 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13368, RRID:AB_2846387.
Fold/Unfold
ACAT related gene product 1; ACAT-related gene product 1; Acyl coenzyme A:cholesterol acyltransferase related gene 1; Acyl-CoA retinol O-fatty-acyltransferase; Acyl-CoA:diacylglycerol acyltransferase; ARAT; ARGP1; C75990; D15Ertd23e; Dgat; DGAT1; DGAT1_HUMAN; Diacylglycerol O acyltransferase 1; Diacylglycerol O-acyltransferase 1; DIAR7; Diglyceride acyltransferase; EC 2.3.1.20; hCG_24006; MGC139064; Retinol O fatty acyltransferase;
Immunogens
A synthesized peptide derived from human DGAT1, corresponding to a region within the internal amino acids.
- O75907 DGAT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Endoplasmic reticulum membrane>Multi-pass membrane protein. 
Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
Research Fields
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Digestive system > Fat digestion and absorption.
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.
 
											 
											 
											