PF4 Antibody - #DF13361
Product: | PF4 Antibody |
Catalog: | DF13361 |
Description: | Rabbit polyclonal antibody to PF4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig |
Mol.Wt.: | 10kDa; 11kD(Calculated). |
Uniprot: | P02776 |
RRID: | AB_2846380 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13361, RRID:AB_2846380.
Fold/Unfold
C-X-C motif chemokine 4;Chemokine (C X C motif) ligand 4;Chemokine (CXC motif) ligand 4;chemokine ligand 4;CXCL 4;CXCL4;Iroplact;MGC138298;Oncostatin A;Oncostatin-A;OncostatinA;PF 4;PF-4;PF4;Pf4a;Platelet factor 4;PLF4_HUMAN;SCYB 4;SCYB4;short form;Small inducible cytokine subfamily B;Small inducible cytokine subfamily member 4 antibody
Immunogens
- P02776 PLF4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.
Secreted.
Homotetramer.
Belongs to the intercrine alpha (chemokine CxC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.