ERp29 Antibody - #DF13338
| Product: | ERp29 Antibody |
| Catalog: | DF13338 |
| Description: | Rabbit polyclonal antibody to ERp29 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 28kDa; 29kD(Calculated). |
| Uniprot: | P30040 |
| RRID: | AB_2846357 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13338, RRID:AB_2846357.
Fold/Unfold
C12orf8; Chromosome 12 open reading frame 8; Endoplasmic reticulum lumenal protein ERp28; Endoplasmic reticulum protein 29; Endoplasmic reticulum protein 29 isoform 1; Endoplasmic reticulum protein ERp29; Endoplasmic reticulum resident protein 28; Endoplasmic reticulum resident protein 29; Endoplasmic reticulum resident protein 31; Epididymis secretory protein Li 107; ERp28; ERP29_HUMAN; ERp31; HEL S 107; PDI-DB; PDIA9; Protein disulfide isomerase family A member 9;
Immunogens
- P30040 ERP29_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P30040 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y47 | Phosphorylation | Uniprot | |
| K48 | Ubiquitination | Uniprot | |
| Y64 | Phosphorylation | Uniprot | |
| Y66 | Phosphorylation | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| S80 | Phosphorylation | Uniprot | |
| S83 | Phosphorylation | Uniprot | |
| Y119 | Phosphorylation | Uniprot | |
| R122 | Methylation | Uniprot | |
| T133 | Phosphorylation | Uniprot | |
| K137 | Ubiquitination | Uniprot | |
| K182 | Ubiquitination | Uniprot | |
| K192 | Ubiquitination | Uniprot | |
| T222 | Phosphorylation | Uniprot | |
| K243 | Ubiquitination | Uniprot | |
| S244 | Phosphorylation | Uniprot | |
| T249 | Phosphorylation | Uniprot |
Research Backgrounds
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Endoplasmic reticulum lumen. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Ubiquitous. Mostly expressed in secretory tissues.
Homodimer. Part of a large chaperone multiprotein complex comprising CABP1, DNAJB11, HSP90B1, HSPA5, HYOU, PDIA2, PDIA4, PPIB, SDF2L1, UGT1A1 and very small amounts of ERP29, but not, or at very low levels, CALR nor CANX.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.