Phospho-DARPP32 (Thr75) Antibody - #AF3487
Product: | Phospho-DARPP32 (Thr75) Antibody |
Catalog: | AF3487 |
Description: | Rabbit polyclonal antibody to Phospho-DARPP32 (Thr75) |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 32kDa; 23kD(Calculated). |
Uniprot: | Q9UD71 |
RRID: | AB_2834925 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3487, RRID:AB_2834925.
Fold/Unfold
DARPP 32; DARPP-32; Dopamine and cAMP regulated neuronal phosphoprotein 32; Dopamine and cAMP regulated neuronal phosphoprotein; Dopamine and cAMP regulated phosphoprotein; Dopamine and cAMP regulated phosphoprotein DARPP 32; Dopamine and cAMP regulated phosphoprotein DARPP32; Dopamine- and cAMP-regulated neuronal phosphoprotein; FLJ20940; IPPD; Neuronal phosphoprotein DARPP 32; PPP1R1B; PPR1B_HUMAN; Protein phosphatase 1 regulatory (inhibitor) subunit 1B; Protein phosphatase 1 regulatory inhibitor subunit 1B; Protein phosphatase 1 regulatory subunit 1B;
Immunogens
- Q9UD71 PPR1B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UD71 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S12 | Phosphorylation | Uniprot | |
S18 | Phosphorylation | Uniprot | |
T34 | Phosphorylation | P17612 (PRKACA) | Uniprot |
S45 | Phosphorylation | Uniprot | |
S46 | Phosphorylation | Uniprot | |
S52 | Phosphorylation | Uniprot | |
S58 | Phosphorylation | Uniprot | |
Y74 | Phosphorylation | Uniprot | |
T75 | Phosphorylation | Q00535 (CDK5) | Uniprot |
S78 | Phosphorylation | Uniprot | |
S102 | Phosphorylation | Uniprot | |
Y116 | Phosphorylation | Uniprot | |
S137 | Phosphorylation | Uniprot | |
S148 | Phosphorylation | Uniprot | |
S172 | Phosphorylation | Uniprot | |
S178 | Phosphorylation | Uniprot | |
S188 | Phosphorylation | Uniprot |
Research Backgrounds
Inhibitor of protein-phosphatase 1.
Dopamine- and cyclic AMP-regulated neuronal phosphoprotein.
Phosphorylation of Thr-34 is required for activity.
Cytoplasm.
Belongs to the protein phosphatase inhibitor 1 family.
Research Fields
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Human Diseases > Substance dependence > Cocaine addiction.
· Human Diseases > Substance dependence > Amphetamine addiction.
· Human Diseases > Substance dependence > Alcoholism.
· Organismal Systems > Nervous system > Dopaminergic synapse.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.