Prolactin Receptor Antibody - #DF13327
Product: | Prolactin Receptor Antibody |
Catalog: | DF13327 |
Description: | Rabbit polyclonal antibody to Prolactin Receptor |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Sheep, Rabbit |
Mol.Wt.: | 69kDa; 70kD(Calculated). |
Uniprot: | P16471 |
RRID: | AB_2846346 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13327, RRID:AB_2846346.
Fold/Unfold
AI987712; CLONE SPM213; CPRLP; Delta 4-delta 7/11 truncated prolactin receptor; Delta 4-SF1b truncated prolactin receptor; HPRL; hPRL receptor; hPRLrI; Lactogen receptor; MFAB; MGC105486; OPR; OTTHUMP00000115998; Pr-1; Pr-3; PRL R; PRL-R; PRLR; Prlr-rs1; PRLR_HUMAN; Prolactin receptor a; Prolactin receptor; Prolactin receptor delta 7/11; RATPRLR; Secreted prolactin binding protein; Truncated testis-specific box 1-C prolactin receptor; wu:fj65c07;
Immunogens
- P16471 PRLR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P16471 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S195 | Phosphorylation | Uniprot | |
Y202 | Phosphorylation | Uniprot | |
S349 | Phosphorylation | P49841 (GSK3B) | Uniprot |
S356 | Phosphorylation | Uniprot | |
S358 | Phosphorylation | Uniprot | |
S361 | Phosphorylation | Uniprot | |
T391 | Phosphorylation | Uniprot | |
T415 | Phosphorylation | Uniprot | |
Y509 | Phosphorylation | Uniprot | |
S522 | Phosphorylation | Uniprot | |
S600 | Phosphorylation | Uniprot | |
Y611 | Phosphorylation | Uniprot |
Research Backgrounds
This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.
Membrane>Single-pass type I membrane protein.
Secreted.
Expressed in breast, placenta, kidney, liver and pancreas.
Homodimer upon hormone binding. Interacts with SMARCA1. Interacts with GH1. Interacts with CSH. Interacts with NEK3 and VAV2 and this interaction is prolactin-dependent.
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
Belongs to the type I cytokine receptor family. Type 1 subfamily.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Prolactin signaling pathway. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.