Syntaxin 2 Antibody - #DF13316
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13316, RRID:AB_2846335.
Fold/Unfold
EPIM; Epimorphin; EPM; MGC51014; OTTHUMP00000238636; OTTHUMP00000238637; Stx2; STX2_HUMAN; STX2A; STX2B; STX2C; Syntaxin 2A; Syntaxin 2B; Syntaxin 2C; Syntaxin-2;
Immunogens
- P32856 STX2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P32856 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y49 | Phosphorylation | Uniprot | |
| K55 | Methylation | Uniprot | |
| K55 | Ubiquitination | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K71 | Methylation | Uniprot | |
| K87 | Acetylation | Uniprot | |
| K91 | Acetylation | Uniprot | |
| K93 | Acetylation | Uniprot | |
| K93 | Ubiquitination | Uniprot | |
| K125 | Methylation | Uniprot | |
| K199 | Acetylation | Uniprot |
Research Backgrounds
Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.
Membrane>Single-pass type IV membrane protein.
Interacts with SYT6 and SYT8; the interaction is Ca(2+)-dependent.
Belongs to the syntaxin family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.