CXCL16 Antibody - #DF13312

(3)   (10)  
Product: CXCL16 Antibody
Catalog: DF13312
Description: Rabbit polyclonal antibody to CXCL16
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 27kDa, 45 kDa; 28kD(Calculated).
Uniprot: Q9H2A7
RRID: AB_2846331

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CXCL16 Antibody detects endogenous levels of total CXCL16.
RRID:
AB_2846331
Cite Format: Affinity Biosciences Cat# DF13312, RRID:AB_2846331.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C-X-C motif chemokine 16; Chemokine (C X C motif) ligand 16; Chemokine, CXC motif, ligand 16; CXC chemokine ligand 16; Cxcl16; CXCLG16; CXL16_HUMAN; Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SCYB16; Small inducible cytokine B16 precursor; Small-inducible cytokine B16; SR-PSOX; SRPSOX; Transmembrane chemokine CXCL16; UNQ2759/PRO6714;

Immunogens

Immunogen:
Uniprot:

Q9H2A7(CXL16_HUMAN) >>Visit HPA database.

Gene(ID):
CXCL16(58191)
Expression:
Q9H2A7 CXL16_HUMAN:

Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.

Sequence:
MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT

PTMs - Q9H2A7 As Substrate

Site PTM Type Enzyme
S45 Phosphorylation
S46 Phosphorylation
S48 Phosphorylation
S95 Phosphorylation

Research Backgrounds

Function:

Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo.

PTMs:

Glycosylated.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein. Secreted.
Note: Also exists as a soluble form.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.

Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

References

1). A Mouse Model of Damp-Heat Syndrome in Traditional Chinese Medicine and Its Impact on Pancreatic Tumor Growth. Frontiers in Oncology (PubMed: 35957897) [IF=4.7]

Application: WB    Species: Mice    Sample: tumor tissues

Figure 6 Chemokine differences between tumor-bearing mice with and without damp-heat syndrome. (A) Heatmap indicating serum chemokine distribution between the two groups (n = 10 in the T group, n = 9 in the TD group). (B) Heatmap indicating tumor tissue chemokine distribution between the two groups (n = 3 in each group). (C) Relative mRNA expression of tissue chemokines tested by qPCR (n = 10 in the T group, n = 9 in the TD group). (D) Relative protein expression of tissue chemokines tested by western blotting (n = 8 in each group). *p < 0.05, **p < 0.01, ***p < 0.001 compared with the T group.
2). Ginsenoside Rg1 Improves Inflammation and Autophagy of the Pancreas and Spleen in Streptozotocin-Induced Type 1 Diabetic Mice. International Journal of Endocrinology (PubMed: 36960388) [IF=2.8]
3). YAP1/MMP7/CXCL16 axis affects efficacy of neoadjuvant chemotherapy via tumor environment immunosuppression in triple-negative breast cancer. Gland Surgery (PubMed: 34733729) [IF=1.8]

Application: WB    Species: Human    Sample: HCC70 cell

Figure 4 Western blotting assay was employed to measure cytoplasmic YAP1 as well as soluble MMP7 and CXCL16 in extracellular matrix in MDA-MB-231 and HCC70 cell lines, respectively. Modulation sequence of protein expression was estimated via YAP1 inhibitor (verteporfin) and MMPs inhibitor (GM6001). Results were statistically analyzed

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.