FKBP51 Antibody - #DF13305

Product: | FKBP51 Antibody |
Catalog: | DF13305 |
Description: | Rabbit polyclonal antibody to FKBP51 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 51kDa; 51kD(Calculated). |
Uniprot: | Q13451 |
RRID: | AB_2846324 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13305, RRID:AB_2846324.
Fold/Unfold
51 kDa FK506 binding protein 5; 51 kDa FK506 binding protein; 51 kDa FK506-binding protein; 51 kDa FKBP; 54 kDa progesterone receptor associated immunophilin; 54 kDa progesterone receptor-associated immunophilin; AIG 6; AIG6; Androgen regulated protein 6; Androgen-regulated protein 6; FF1 antigen; FK506 binding protein 5; FK506-binding protein 5; FKBP 5; FKBP 51; FKBP 54; FKBP-5; FKBP-51; FKBP5; FKBP5_HUMAN; FKBP54; HSP90 binding immunophilin; HSP90-binding immunophilin; MGC111006; OTTHUMP00000016268; P54; Peptidyl prolyl cis trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP5; Peptidylprolyl cis trans isomerase; PPIase; PPIase FKBP5; Ptg 10; Ptg10; Rotamase; T cell FK506 binding protein;
Immunogens
- Q13451 FKBP5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13451 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S13 | Phosphorylation | Uniprot | |
T15 | Phosphorylation | Uniprot | |
K28 | Acetylation | Uniprot | |
K28 | Ubiquitination | Uniprot | |
Y54 | Phosphorylation | Uniprot | |
K155 | Acetylation | Uniprot | |
K208 | Ubiquitination | Uniprot | |
Y243 | Phosphorylation | Uniprot | |
K248 | Acetylation | Uniprot | |
K248 | Ubiquitination | Uniprot | |
K274 | Ubiquitination | Uniprot | |
K342 | Ubiquitination | Uniprot | |
K352 | Ubiquitination | Uniprot | |
R357 | Methylation | Uniprot | |
K376 | Ubiquitination | Uniprot | |
K385 | Ubiquitination | Uniprot | |
Y409 | Phosphorylation | Uniprot | |
K414 | Acetylation | Uniprot | |
K415 | Acetylation | Uniprot | |
K422 | Sumoylation | Uniprot | |
K422 | Ubiquitination | Uniprot | |
T433 | Phosphorylation | Uniprot | |
S434 | Phosphorylation | Uniprot | |
K441 | Acetylation | Uniprot | |
K441 | Ubiquitination | Uniprot | |
T443 | Phosphorylation | Uniprot | |
S445 | Phosphorylation | Uniprot |
Research Backgrounds
Immunophilin protein with PPIase and co-chaperone activities. Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). Plays a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors maintaining the complex into the cytoplasm when unliganded. Acts as a regulator of Akt/AKT1 activity by promoting the interaction between Akt/AKT1 and PHLPP1, thereby enhancing dephosphorylation and subsequent activation of Akt/AKT1.
Acetylation impairs ability to promote interaction between Akt/AKT1 and PHLPP1. Deacetylation by SIRT7 promotes interaction between Akt/AKT1 and PHLPP1, leading to suppress Akt/AKT1 activation.
Cytoplasm. Nucleus.
Widely expressed, enriched in testis compared to other tissues.
Part of a heteromultimeric cytoplasmic complex with HSP90AA1, HSPA1A/HSPA1B and steroid receptors. Upon ligand binding dissociates from the complex and FKBP4 takes its place (By similarity). Interacts with functionally mature heterooligomeric progesterone receptor complexes along with HSP90 and TEBP. Interacts with NR3C1 (By similarity). Interacts with Akt/AKT1 and PHLPP1; enhancing dephosphorylation and subsequent activation of Akt/AKT1.
Research Fields
· Organismal Systems > Endocrine system > Estrogen signaling pathway. (View pathway)
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.