ARF3 Antibody - #DF13284
Product: | ARF3 Antibody |
Catalog: | DF13284 |
Description: | Rabbit polyclonal antibody to ARF3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Chicken, Xenopus |
Mol.Wt.: | 20kDa; 21kD(Calculated). |
Uniprot: | P61204 |
RRID: | AB_2846303 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13284, RRID:AB_2846303.
Fold/Unfold
ADP ribosylation factor 3; ADP-ribosylation factor 3; ARF3; ARF3_HUMAN; small GTP binding protein;
Immunogens
- P61204 ARF3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P61204 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K15 | Ubiquitination | Uniprot | |
Y35 | Phosphorylation | Uniprot | |
K36 | Acetylation | Uniprot | |
K36 | Ubiquitination | Uniprot | |
K38 | Ubiquitination | Uniprot | |
Y58 | Phosphorylation | Uniprot | |
S62 | Phosphorylation | Uniprot | |
K73 | Sumoylation | Uniprot | |
K73 | Ubiquitination | Uniprot | |
R117 | Methylation | Uniprot | |
K127 | Ubiquitination | Uniprot | |
T140 | Phosphorylation | Uniprot | |
K142 | Acetylation | Uniprot | |
K142 | Ubiquitination | Uniprot | |
S147 | Phosphorylation | Uniprot | |
Y167 | Phosphorylation | Uniprot |
Research Backgrounds
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Golgi apparatus. Cytoplasm>Perinuclear region.
Interacts with PRKCABP. Interacts with PI4KB and NCS1/FREQ at the Golgi complex.
Belongs to the small GTPase superfamily. Arf family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.