TEAD4 Antibody - #DF13283
| Product: | TEAD4 Antibody |
| Catalog: | DF13283 |
| Description: | Rabbit polyclonal antibody to TEAD4 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Horse, Sheep, Rabbit, Chicken |
| Mol.Wt.: | 48kDa, 60 kDa; 48kD(Calculated). |
| Uniprot: | Q15561 |
| RRID: | AB_2846302 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13283, RRID:AB_2846302.
Fold/Unfold
EFTR 2; EFTR2; hRTEF 1B; hRTEF1B; MGC9014; OTTHUMP00000238119; OTTHUMP00000238122; OTTHUMP00000238124; Related to TEF 1; Related to TEF1; Related transcription enhancer factor 1B; RTEF1; TCF13L1; TEA domain family member 4; TEAD 4; TEAD-4; TEAD4; TEAD4_HUMAN; TEF 3; TEF3; TEFR 1; TEFR1; Transcription factor 13 (SV40 transcriptional enhancer factor) like 1; Transcription factor 13 like 1; Transcription factor 13-like 1; Transcription factor RTEF 1; Transcription factor RTEF-1; Transcription factor RTEF1; Transcriptional enhancer factor 1 related; Transcriptional enhancer factor 3; Transcriptional enhancer factor TEF 3; Transcriptional enhancer factor TEF-3; Transcriptional enhancer factor TEF3;
Immunogens
Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart.
- Q15561 TEAD4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15561 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K65 | Ubiquitination | Uniprot | |
| S69 | Phosphorylation | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| Y84 | Phosphorylation | Uniprot | |
| K91 | Methylation | Uniprot | |
| K96 | Ubiquitination | Uniprot | |
| K123 | Acetylation | Uniprot | |
| K178 | Sumoylation | Uniprot | |
| S198 | Phosphorylation | Uniprot | |
| S254 | Phosphorylation | Uniprot | |
| Y271 | Phosphorylation | Uniprot | |
| K273 | Ubiquitination | Uniprot | |
| K278 | Acetylation | Uniprot | |
| K282 | Acetylation | Uniprot | |
| K282 | Ubiquitination | Uniprot | |
| S322 | Phosphorylation | Uniprot | |
| K339 | Ubiquitination | Uniprot | |
| Y349 | Phosphorylation | Uniprot | |
| Y352 | Phosphorylation | Uniprot | |
| Y357 | Phosphorylation | Uniprot | |
| S420 | Phosphorylation | Uniprot |
Research Backgrounds
Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.
Nucleus.
Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart.
Interacts with YAP1 and WWTR1/TAZ.
Research Fields
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway - multiple species. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.