Myelin PLP Antibody - #DF13282
Product: | Myelin PLP Antibody |
Catalog: | DF13282 |
Description: | Rabbit polyclonal antibody to Myelin PLP |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 30kDa; 30kD(Calculated). |
Uniprot: | P60201 |
RRID: | AB_2846301 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13282, RRID:AB_2846301.
Fold/Unfold
HLD1; Lipophilin; Major myelin proteolipid protein; MMPL; Myelin proteolipid protein; MYPR_HUMAN; PLP 1; PLP; PLP/DM20; PLP1; PMD; Proteolipid protein 1; SPG2;
Immunogens
- P60201 MYPR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P60201 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S114 | Phosphorylation | Uniprot | |
T116 | Phosphorylation | Uniprot | |
T118 | Phosphorylation | Uniprot |
Research Backgrounds
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Cell membrane>Multi-pass membrane protein. Myelin membrane.
Note: Colocalizes with SIRT2 in internodal regions, at paranodal axoglial junction and Schmidt-Lanterman incisures of myelin sheat.
Belongs to the myelin proteolipid protein family.
References
Application: WB Species: Rat Sample: brain tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.