Product: CD36 Antibody
Catalog: DF13262
Description: Rabbit polyclonal antibody to CD36
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Rabbit
Mol.Wt.: 53kDa, 88kD, 60~110kDa; 53kD(Calculated).
Uniprot: P16671
RRID: AB_2846281

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Rabbit(88%)
Clonality:
Polyclonal
Specificity:
CD36 Antibody detects endogenous levels of total CD36.
RRID:
AB_2846281
Cite Format: Affinity Biosciences Cat# DF13262, RRID:AB_2846281.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Adipocyte membrane protein; BDPLT10; CD36; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 antigen; CD36 molecule (thrombospondin receptor); CD36 molecule; CD36_HUMAN; CHDS7; Cluster determinant 36; Collagen receptor, platelet; FAT; Fatty acid translocase; Fatty acid transport protein; Glycoprotein IIIb; GP IIIb; GP3B; GP4; GPIIIB; GPIV; Leukocyte differentiation antigen CD36; MGC108510; MGC91634; PAS 4 protein; PAS IV; PAS-4; PASIV; Platelet collagen receptor; Platelet glycoprotein 4; Platelet glycoprotein IV; scarb3; Scavenger receptor class B member 3; Thrombospondin receptor;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
88
Dog
75
Pig
63
Bovine
63
Chicken
50
Horse
0
Sheep
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P16671 As Substrate

Site PTM Type Enzyme
T57 Phosphorylation
Y62 Phosphorylation
T92 Phosphorylation P17252 (PRKCA)
N205 N-Glycosylation
K298 Acetylation
N321 N-Glycosylation
T323 Phosphorylation
N417 N-Glycosylation
K469 Ubiquitination
K472 Ubiquitination

Research Backgrounds

Function:

Multifunctional glycoprotein that acts as receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids and bacterial diacylated lipopeptides. They are generally multivalent and can therefore engage multiple receptors simultaneously, the resulting formation of CD36 clusters initiates signal transduction and internalization of receptor-ligand complexes. The dependency on coreceptor signaling is strongly ligand specific. Cellular responses to these ligands are involved in angiogenesis, inflammatory response, fatty acid metabolism, taste and dietary fat processing in the intestine (Probable). Binds long-chain fatty acids and facilitates their transport into cells, thus participating in muscle lipid utilization, adipose energy storage, and gut fat absorption (By similarity). In the small intestine, plays a role in proximal absorption of dietary fatty acid and cholesterol for optimal chylomicron formation, possibly through the activation of MAPK1/3 (ERK1/2) signaling pathway (By similarity). Involved in oral fat perception and preferences. Detection into the tongue of long-chain fatty acids leads to a rapid and sustained rise in flux and protein content of pancreatobiliary secretions (By similarity). In taste receptor cells, mediates the induction of an increase in intracellular calcium levels by long-chain fatty acids, leading to the activation of the gustatory neurons in the nucleus of the solitary tract (By similarity). Important factor in both ventromedial hypothalamus neuronal sensing of long-chain fatty acid and the regulation of energy and glucose homeostasis (By similarity). Receptor for thombospondins, THBS1 and THBS2, mediating their antiangiogenic effects (By similarity). As a coreceptor for TLR4:TLR6 heterodimer, promotes inflammation in monocytes/macrophages. Upon ligand binding, such as oxLDL or amyloid-beta 42, interacts with the heterodimer TLR4:TLR6, the complex is internalized and triggers inflammatory response, leading to NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion, through the priming and activation of the NLRP3 inflammasome (By similarity). Selective and nonredundant sensor of microbial diacylated lipopeptide that signal via TLR2:TLR6 heterodimer, this cluster triggers signaling from the cell surface, leading to the NF-kappa-B-dependent production of TNF, via MYD88 signaling pathway and subsequently is targeted to the Golgi in a lipid-raft dependent pathway (By similarity).

(Microbial infection) Directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and the internalization of particles independently of TLR signaling.

PTMs:

N-glycosylated and O-glycosylated with a ratio of 2:1.

Ubiquitinated at Lys-469 and Lys-472. Ubiquitination is induced by fatty acids such as oleic acid and leads to degradation by the proteasome. Ubiquitination and degradation are inhibited by insulin which blocks the effect of fatty acids.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Membrane raft. Golgi apparatus. Apical cell membrane.
Note: Upon ligand-binding, internalized through dynamin-dependent endocytosis.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with THBS1 and THBS2; the interactions mediate the THBS antiangiogenic activity. Upon interaction with a ligand, such as oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42, rapidly forms a complex with TLR4 and TLR6; the complex is internalized and triggers an inflammatory signal. Through its C-terminus, interacts with PTK2, PXN and LYN, but not with SRC. LYN kinase activity is required for facilitating TLR4:TLR6 heterodimerization and signal initiation. Upon interaction with ligands such as diacylated lipopeptides, interacts with the TLR2:TLR6 heterodimer. Interacts with CD9, CD81, FCER1G, ITGB2 and/or ITGB2; forming a membrane heteromeric complex required for the internalization of CD36 and its ligands (By similarity).

(Microbial infection) Binds to Plasmodium falciparum EMP1.

Family&Domains:

Belongs to the CD36 family.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Environmental Information Processing > Signal transduction > AMPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > ECM-receptor interaction.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

· Organismal Systems > Endocrine system > Adipocytokine signaling pathway.

· Organismal Systems > Digestive system > Fat digestion and absorption.

· Organismal Systems > Digestive system > Cholesterol metabolism.

References

1). Metabolomics reveals that CAF-derived lipids promote colorectal cancer peritoneal metastasis by enhancing membrane fluidity. International Journal of Biological Sciences, 2022 (PubMed: 35342344) [IF=8.2]

Application: WB    Species: human    Sample: DLD1 cells

Figure 6. | Uptake of CAF-derived lipids by CRC through increased membrane fluidity.F, Western blot showing CD36 expression in DLD1 cells incubated with CAF-CM.

2). Apolipoprotein C-II induces EMT to promote gastric cancer peritoneal metastasis via PI3K/AKT/mTOR pathway. Clinical and Translational Medicine, 2021 (PubMed: 34459127) [IF=7.9]

Application: WB    Species: Mouse    Sample: OE APOC2 AGS cells

FIGURE 7 APOC2 cooperates with CD36 to promote tumor progression and PM in GC. (A) Flag‐APOC2 interacts with His‐CD36 in AGS and BGC‐823 cells. The cells were cotransfected with Flag‐APOC2 and His‐CD36. For the co‐IP assays, anti‐FLAG antibody was used for pulldown and anti‐His antibody was detected by western blot. (B) Measurement of the binding affinity of APOC2 peptide to CD36 by biolayer interferometry method. Various concentrations of APOC2 peptide were shown. (C–E) The effect of knocking down CD36 on the migration, invasion, and proliferation of OE APOC2 stable cells. (F) The levels of p‐PI3K, p‐AKT, p‐mTOR, E cadherin, N‐cadherin, vimentin, Snail, Slug, Twist1, MMP‐2, and MMP‐9 proteins detected by western blot in OE APOC2 AGS cells transduced with shCD36 lentiviral particles. (G–I) Representative images of the macroscopic appearance and hematoxylin and eosin (H&E) staining of PM nodules in nude mice treated with intraperitoneal injection of AGS OE APOC2/shCtrol, AGS OE APOC2/shCD36, AGS OE CD36/shCtrol, and AGS OE CD36/shAPOC2 cells, respectively (n = 6 per group). The total number (H) and weight (I) of PM nodules in the respective groups. Data are shown as mean ± SD; ns, no significant difference; *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001, based on Student's t‐test

3). White adipose tissue, a novel antirheumatic target: Clues from its secretory capability and adipectomy-based therapy. British journal of pharmacology, 2024 (PubMed: 38644540) [IF=6.8]

4). Astragaloside IV attenuates myocardial dysfunction in diabetic cardiomyopathy rats through downregulation of CD36-mediated ferroptosis. Phytotherapy Research, 2023 (PubMed: 36882189) [IF=6.1]

5). Xinbao Pill ameliorates heart failure via regulating the SGLT1/AMPK/PPARα axis to improve myocardial fatty acid energy metabolism. Chinese medicine, 2024 (PubMed: 38862959) [IF=5.3]

6). QiShenYiQi pill inhibits atherosclerosis by promoting reverse cholesterol transport PPARγ-LXRα/β-ABCA1 pathway. Journal of ethnopharmacology, 2023 (PubMed: 37230281) [IF=4.8]

Application: IHC    Species: Mouse    Sample:

Fig. 6. The effect of QSYQ on the expression of CD36, PPARγ, LXRα/β, and ABCA1 in atherosclerotic plaque. (A) Representative pictures of CD36, PPARγ, LXRα/β, and ABCA1 immunohistochemical staining in the aortic root of each group. Scale bar = 100 μm. (B) The positive staining area and plaque area were measured by image J analysis software, and the ratio of the positive staining area and plaque area was calculated. ★, P<0.05, ★★, P<0.01, considered as significant difference. n.s., P>0.05, considered as no difference.

7). Severe hypoglycemia exacerbates myocardial dysfunction and metabolic remodeling in diabetic mice. MOLECULAR AND CELLULAR ENDOCRINOLOGY, 2020 (PubMed: 31887336) [IF=3.8]

Application: WB    Species: mouse    Sample: myocardial

Fig. 6. |SH inhibited myocardial metabolism in diabetic mice. Real-time PCR analysis of the gene expression involved in myocardial fatty acid transportation,oxidation, and glucose uptake (n = 8 per group). (B) Gene expression of myocardial transcriptional regulator PPARs (n = 8 per group). (C) Representative immunoblot images of relative protein expression (n = 6 per group).

8). Ginsenoside Rg1 alleviates diabetic liver injury and fibrosis by inhibiting the PLC-NFAT2-NLRP3 signaling pathway in T2DM mice. Journal of Functional Foods, 2024 [IF=3.8]

Application: WB    Species: Mouse    Sample: liver

Fig. 1. Rg1 decreases the expression of CD36 in liver of T2DM mice. (A) The results of CD36 expression in liver (Immunohistochemical staining, 400×, scale bar = 40 µm). (B) The mean density of CD36 staining. (C) The bands of CD36 and GAPDH. (D) Relative expression of CD36. Data are expressed as mean ± SD. n = 4. **P < 0.01 as compared with Control group. #P < 0.05, ##P < 0.01 as compared with HFD + STZ group.

9). Three polymethoxyflavones from the peel of Citrus reticulata “Chachi” inhibits oxidized low-density lipoprotein-induced macrophage-derived foam cell formation. Frontiers in Cardiovascular Medicine, 2022 (PubMed: 35966555) [IF=2.8]

Application: WB    Species: Mice    Sample: RAW264.7 cells

FIGURE 5 Effects of TAN, HxMF, and HpMF on mRNA expression of SRA1 in ox-LDL-treated RAW264.7 cells (A); effects of TAN, HxMF, and HpMF on mRNA expression of CD36 in ox-LDL-treated RAW264.7 cells (B); effects of TAN on SRA1 and CD36 protein expression in ox- LDL-treated RAW264.7 cells (C1,C2); effects of HxMF on SRA1 and CD36 protein expression in ox-LDL-treated RAW264.7 cells (D1,D2); and effects of HpMF on SRA1 and CD36 protein expression in ox-LDL-treated RAW264.7 cells (E1,E2). All experiments were run in triplicate, and data showed mean ± SD. ##p < 0.01 compared with the control group, *p < 0.05 and **p < 0.01 compared with the ox-LDL group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.