cbx7 Antibody - #DF13257
Product: | cbx7 Antibody |
Catalog: | DF13257 |
Description: | Rabbit polyclonal antibody to cbx7 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 28kDa; 28kD(Calculated). |
Uniprot: | O95931 |
RRID: | AB_2846276 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13257, RRID:AB_2846276.
Fold/Unfold
Cbx 7; CBX7; Chromobox homolog 7; Chromobox protein homolog 7;
Immunogens
- O95931 CBX7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95931 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S15 | Phosphorylation | Uniprot | |
K75 | Acetylation | Uniprot | |
K77 | Acetylation | Uniprot | |
Y85 | Phosphorylation | Uniprot | |
S86 | Phosphorylation | Uniprot | |
S91 | Phosphorylation | Uniprot | |
S92 | Phosphorylation | Uniprot | |
T134 | Phosphorylation | Uniprot | |
S167 | Phosphorylation | Uniprot |
Research Backgrounds
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.
Nucleus.
Component of a PRC1-like complex. Interacts with RING1 and RNF2/RING1B, but not with BMI1, EED or EZH2. Interacts with PCGF1, PCGF2, PCGF3, PCGF5 and PCGF6.
References
Application: WB Species: Human Sample: BLCA cell and tissue
Application: IF/ICC Species: Human Sample: BLCA cell and tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.