Dectin-1 Antibody - #DF13249
| Product: | Dectin-1 Antibody |
| Catalog: | DF13249 |
| Description: | Rabbit polyclonal antibody to Dectin-1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Rabbit, Dog |
| Mol.Wt.: | 27kDa, 37 kDa; 28kD(Calculated). |
| Uniprot: | Q9BXN2 |
| RRID: | AB_2846268 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13249, RRID:AB_2846268.
Fold/Unfold
Beta GR; Beta-glucan receptor; BGR; C type calcium dependent carbohydrate recognition domain lectin superfamily member 12; C type lectin domain family 7 member a; C-type lectin domain family 7 member A; C-type lectin superfamily member 12; CANDF4; CLC7A_HUMAN; CLEC7A; CLEC7A protein; Clecsf12; DC-associated C-type lectin 1; Dectin 1; DECTIN 1 receptor; Dectin-1; Dectin1; Dendritic cell associated C type lectin 1; Dendritic cell-associated C-type lectin 1; Lectin like receptor 1; Putative transmembrane protein dectin 1;
Immunogens
Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.
- Q9BXN2 CLC7A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BXN2 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y15 | Phosphorylation | Uniprot | |
| S32 | Phosphorylation | Uniprot | |
| T105 | Phosphorylation | Uniprot | |
| K157 | Ubiquitination | Uniprot | |
| S160 | Phosphorylation | Uniprot | |
| K169 | Ubiquitination | Uniprot |
Research Backgrounds
Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Induces phosphorylation of SCIMP after binding beta-glucans (By similarity). Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation (By similarity).
Phosphorylated on tyrosine residues in response to glucan binding.
Cell membrane>Single-pass type II membrane protein.
Cytoplasm.
Cytoplasm.
Cytoplasm.
Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.
Homodimer (By similarity). Interacts with SYK; participates in leukocyte activation in presence of fungal pathogens (By similarity). Isoform 5 interacts with RANBP9.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.