CoREST Antibody - #DF13230
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13230, RRID:AB_2846249.
Fold/Unfold
COREST; KIAA0071; Nr2b2; Nuclear receptor coregulator 1; Nuclear receptor subfamily 2 group B member 2; Protein CoREST; RCOR; Rcor1; RCOR1_HUMAN; REST corepressor 1; Retinoic acid receptor RXR-beta; Retinoid X receptor beta; Rxrb;
Immunogens
- Q9UKL0 RCOR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UKL0 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S12 | Phosphorylation | Uniprot | |
| S94 | Phosphorylation | Uniprot | |
| S96 | Phosphorylation | Uniprot | |
| K122 | Ubiquitination | Uniprot | |
| S127 | Phosphorylation | Uniprot | |
| S139 | Phosphorylation | Uniprot | |
| Y152 | Phosphorylation | Uniprot | |
| K157 | Ubiquitination | Uniprot | |
| K180 | Ubiquitination | Uniprot | |
| T189 | Phosphorylation | Uniprot | |
| S235 | Phosphorylation | Uniprot | |
| S260 | Phosphorylation | Uniprot | |
| K297 | Sumoylation | Uniprot | |
| K356 | Ubiquitination | Uniprot | |
| S360 | Phosphorylation | Uniprot | |
| K365 | Ubiquitination | Uniprot | |
| Y373 | Phosphorylation | Uniprot | |
| K381 | Ubiquitination | Uniprot | |
| K421 | Acetylation | Uniprot | |
| K421 | Ubiquitination | Uniprot | |
| T449 | Phosphorylation | Uniprot | |
| S453 | Phosphorylation | Uniprot | |
| S460 | Phosphorylation | Uniprot | |
| S464 | Phosphorylation | Uniprot | |
| K466 | Ubiquitination | Uniprot |
Research Backgrounds
Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation.
Phosphorylated by HSV-1 protein kinases in case of infection.
Nucleus.
Note: Upon infection by HSV-1, it is partially translocated into the cytoplasm in an HSV-1-dependent manner.
Ubiquitously expressed.
Interacts directly with GFI1 and GFI1B in a RCOR/GFI/KDM1A/HDAC complex. Interacts with INMS1 (By similarity). Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Interacts with REST. Interacts with the SMARCE1/BAF57, suggesting that the BHC complex may recruit the ATP-dependent chromatin-remodeling SWI-SNF complex.
(Microbial infection) Interacts with herpes virus HSV-1 ICP0 protein; the interaction leads to the disruption of the BHC complex, thereby preventing the BHC complex from repressing transcription of viral genes.
The SANT domains may bridge the nucleosomal substrates and the demethylase KDM1A.
Belongs to the CoREST family.
Research Fields
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.