Product: Collagen X Antibody
Catalog: DF13214
Description: Rabbit polyclonal antibody to Collagen X
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Chicken
Mol.Wt.: 66kDa; 66kD(Calculated).
Uniprot: Q03692
RRID: AB_2846233

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(88%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
Collagen X Antibody detects endogenous levels of total Collagen X.
RRID:
AB_2846233
Cite Format: Affinity Biosciences Cat# DF13214, RRID:AB_2846233.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

COAA1_HUMAN; Col10a 1; COL10A1; Collagen alpha 1(X) chain; Collagen alpha-1(X) chain; Collagen type X alpha 1 (Schmid metaphyseal chondrodysplasia); Collagen type X alpha 1; Collagen X alpha 1 polypeptide; CollagenX; fa66d11; fb10c08; OTTHUMP00000040411; Procollagen type X alpha 1; Schmid metaphyseal chondrodysplasia; wu:fa66d11; wu:fb10c08;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MLPQIPFLLLVSLNLVHGVFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Sheep
100
Chicken
100
Rabbit
100
Bovine
88
Xenopus
75
Dog
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Type X collagen is a product of hypertrophic chondrocytes and has been localized to presumptive mineralization zones of hyaline cartilage.

PTMs:

Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homotrimer.

Research Fields

· Organismal Systems > Digestive system > Protein digestion and absorption.

References

1). Co-culture pellet of human Wharton’s jelly mesenchymal stem cells and rat costal chondrocytes as a candidate for articular cartilage regeneration: in vitro and in vivo study. Stem Cell Research & Therapy, 2022 (PubMed: 35907866) [IF=7.5]

Application: IHC    Species: Rat    Sample:

Fig. 3Histological and immunochemistry staining of pellets with semiquantitative analysis. A H–E and Safranin-O staining of pellets and partial enlargement in five groups. B Immunochemistry staining of COLII and COLX of pellets and partial enlargement in five groups. C–E Semiquantitative analysis of AOI of each staining (n = 4). Significant difference symbols: *p < 0.05, **p < 0.01 compared to CCs group, #p < 0.05, ##p < 0.01 compared to hWJMSCs group

2). Anti-hypertrophic effect of synovium-derived stromal cells on costal chondrocytes promotes cartilage repairs. Journal of Orthopaedic Translation, 2022 (PubMed: 34934627) [IF=6.6]

Application: IHC    Species: Rat    Sample: SDSCs

Figure 2 Paracrine effect of SDSCs toward CCs in indirect coculture. A) Schematic of conditioned medium coculture experimental outline. In light blue: CCs; In yellow: SDSCs; In dark blue: CCs pellet. B) Macroscopic appearance of pellets. C) RT-PCR analysis for chondrogenesis and hypertrophic-related gene expression after 3 weeks of culture. D) H&E staining. E) Alcian blue staining. F, G) Safranin-O staining. H) Biochemical evaluation of GAG content and GAG/DNA ratio of pellets. I, J) Immunohistochemistry analysis of type II collagen. K, L) Immunohistochemistry analysis of type X collagen. M) Western blot analysis of type X collagen. Crtl: Control group. CM: SDSCs-conditioned medium group. (For interpretation of the references to color/colour in this figure legend, the reader is referred to the Web version of this article.)

Application: WB    Species: Rat    Sample: SDSCs

Figure 2 Paracrine effect of SDSCs toward CCs in indirect coculture. A) Schematic of conditioned medium coculture experimental outline. In light blue: CCs; In yellow: SDSCs; In dark blue: CCs pellet. B) Macroscopic appearance of pellets. C) RT-PCR analysis for chondrogenesis and hypertrophic-related gene expression after 3 weeks of culture. D) H&E staining. E) Alcian blue staining. F, G) Safranin-O staining. H) Biochemical evaluation of GAG content and GAG/DNA ratio of pellets. I, J) Immunohistochemistry analysis of type II collagen. K, L) Immunohistochemistry analysis of type X collagen. M) Western blot analysis of type X collagen. Crtl: Control group. CM: SDSCs-conditioned medium group. (For interpretation of the references to color/colour in this figure legend, the reader is referred to the Web version of this article.)

Application: WB    Species: rat    Sample: Costal chondrocytes

Figure 2.| Paracrine effect of SDSCs toward CCs in indirect coculture.M) Western blot analysis of type X collagen. Crtl: Control group. CM: SDSCs-conditioned medium group. (For interpretation of the references to color/colour in this figure legend, the reader is referred to the Web version of this article.)

3). Cartilage Regeneration Characteristics of Human and Goat Auricular Chondrocytes. Frontiers in Bioengineering and Biotechnology, 2021 (PubMed: 34993186) [IF=5.7]

Application: IF/ICC    Species: human and goat    Sample:

FIGURE 3 Phenotypic expression of AUCs during in vitro expansion. (A) Alcian staining, and (B) COL II immunofluorescence staining of human and goats at P1 and P3. Gene quantitative analyses of (C) SOX9, (D) Aggrecan, and (E) Col II in human and goat at P1 and P3. (F–I) Analysis of protein and gene expression levels of COL I and COL X in human and goat at P1 and P3. Data were analyzed using t tests (the relative mRNA levels were compared within the species, instead of comparing between the species). Columns with different letters indicate statistical significance (p < 0.05). Abbreviations: AUCs, auricular chondrocytes; Col II, type II collage; Col I, type I collage; Col X, type X collage. Scale bar = 50 μm.

4). Asiatic acid attenuates hypertrophic and fibrotic differentiation of articular chondrocytes via AMPK/PI3K/AKT signaling pathway. ARTHRITIS RESEARCH & THERAPY, 2020 (PubMed: 32398124) [IF=4.9]

5). Region-specific effects of blocking estrogen receptors on longitudinal bone growth. JOURNAL OF ENDOCRINOLOGY, 2021 (PubMed: 34014834) [IF=4.0]

6). Wnt/PCP-YAP-BIRC2 axis maintains cartilage stem/progenitor cell homeostasis in osteoarthritis. Research Square, 2022

Application: WB    Species: Human    Sample: CSPCs

Figure 4. YAP maintains the function of CSPCs a the protein levels of FAK, Lubricin, and YAP in OA-CSPCs (left) and Col II, Col I, and Col X in OA-chondrocytes (right) that co-cultured for 7 days. OA-CSPCs overexpressing or silencing YAP were evaluated by EdU proliferation assay (b), transwell migration assay (c), and SA-β-Gal staining (d). The cells were counted in five random fields per well. Bars = 100 μm.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.