NOXA Antibody - #DF13193
Product: | NOXA Antibody |
Catalog: | DF13193 |
Description: | Rabbit polyclonal antibody to NOXA |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 11 kDa; 6kD(Calculated). |
Uniprot: | Q13794 |
RRID: | AB_2846153 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13193, RRID:AB_2846153.
Fold/Unfold
Adult T cell leukemia derived PMA responsive; APR; APR_HUMAN; ATL-derived; Immediate early response protein APR; Immediate-early-response protein APR; NOXA; Phorbol 12 myristate 13 acetate induced protein 1; Phorbol-12-myristate-13-acetate-induced protein 1; PMA induced protein 1; PMA-induced protein 1; PMA-responsive gene; Pmaip1; Protein Noxa;
Immunogens
- Q13794 APR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
PTMs - Q13794 As Substrate
Research Backgrounds
Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1 (By similarity). Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1.
Mitochondrion.
Highly expressed in adult T-cell leukemia cell line.
Interacts with MCL1, BCL2A1 and BAX.
The BH3 motif is essential for pro-apoptotic activity.
Belongs to the PMAIP1 family.
Research Fields
· Cellular Processes > Cell growth and death > p53 signaling pathway. (View pathway)
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Cellular Processes > Cell growth and death > Apoptosis - multiple species. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Cancers: Specific types > Colorectal cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.