NNMT Antibody - #DF13190
Product: | NNMT Antibody |
Catalog: | DF13190 |
Description: | Rabbit polyclonal antibody to NNMT |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Dog |
Mol.Wt.: | 30 kDa; 30kD(Calculated). |
Uniprot: | P40261 |
RRID: | AB_2846150 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13190, RRID:AB_2846150.
Fold/Unfold
EC 2.1.1.1; Nicotinamide N methyltransferase; Nicotinamide N-methyltransferase; NNMT; NNMT_HUMAN;
Immunogens
Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas.
- P40261 NNMT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P40261 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S3 | Phosphorylation | Uniprot | |
K8 | Acetylation | Uniprot | |
K8 | Methylation | Uniprot | |
K8 | Ubiquitination | Uniprot | |
Y11 | Phosphorylation | Uniprot | |
K23 | Ubiquitination | Uniprot | |
Y24 | Phosphorylation | Uniprot | |
Y25 | Phosphorylation | Uniprot | |
K26 | Ubiquitination | Uniprot | |
S35 | Phosphorylation | Uniprot | |
K39 | Acetylation | Uniprot | |
K39 | Ubiquitination | Uniprot | |
K43 | Acetylation | Uniprot | |
K43 | Ubiquitination | Uniprot | |
K47 | Ubiquitination | Uniprot | |
K96 | Ubiquitination | Uniprot | |
K100 | Ubiquitination | Uniprot | |
S108 | Phosphorylation | Uniprot | |
Y113 | Phosphorylation | Uniprot | |
K123 | Ubiquitination | Uniprot | |
K136 | Ubiquitination | Uniprot | |
Y203 | Phosphorylation | Uniprot | |
Y204 | Phosphorylation | Uniprot | |
K210 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Cytoplasm.
Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas.
Monomer.
Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Nicotinate and nicotinamide metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.