MFAP5 Antibody - #DF13146
Product: | MFAP5 Antibody |
Catalog: | DF13146 |
Description: | Rabbit polyclonal antibody to MFAP5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig |
Mol.Wt.: | 20 kDa; 20kD(Calculated). |
Uniprot: | Q13361 |
RRID: | AB_2846106 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13146, RRID:AB_2846106.
Fold/Unfold
AAT9; MAGP 2; MAGP-2; MAGP2; MFAP 5; MFAP-5; MFAP5; MFAP5_HUMAN; Microfibril associated glycoprotein 2; Microfibril-associated glycoprotein 2; microfibrillar associated protein 5; Microfibrillar associated protein 5 precursor; Microfibrillar-associated protein 5; MP25;
Immunogens
- Q13361 MFAP5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13361 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T54 | O-Glycosylation | Uniprot | |
N79 | N-Glycosylation | Uniprot |
Research Backgrounds
May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (By similarity). Component of the elastin-associated microfibrils.
Forms intermolecular disulfide bonds either with other MAGP-2 molecules or with other components of the microfibrils.
N- and O-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans. O-glycan heterogeneity at Thr-54: HexHexNAc (major) and HexHexNAc + sulfate (minor).
Secreted>Extracellular space>Extracellular matrix.
Interacts with TGFB2. Interacts with BMP2. Interacts with FBN1 (via N-terminal domain) and FBN2.
Belongs to the MFAP family.
References
Application: WB Species: Mouse Sample: C3H10 and 3T3-L1 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.