MEIS2 Antibody - #DF13142
| Product: | MEIS2 Antibody |
| Catalog: | DF13142 |
| Description: | Rabbit polyclonal antibody to MEIS2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine |
| Mol.Wt.: | 56 kDa; 52kD(Calculated). |
| Uniprot: | O14770 |
| RRID: | AB_2846102 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13142, RRID:AB_2846102.
Fold/Unfold
Homeobox protein Meis2; HsT18361; Meis (mouse) homolog 2; Meis homeobox 2; Meis homolog 2; Meis1 myeloid ecotropic viral integration site 1 homolog 2 (mouse); Meis1 myeloid ecotropic viral integration site 1 homolog 2; Meis1 related gene 1; Meis1 related protein 1; Meis1-related protein 1; MEIS2; MEIS2_HUMAN; MGC2820; MRG1; TALE homeobox protein Meis2;
Immunogens
Expressed in various tissues. Expressed at high level in the lymphoid organs of hematopoietic tissues. Also expressed in some regions of the brain, such as the putamen.
- O14770 MEIS2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O14770 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K180 | Ubiquitination | Uniprot | |
| S198 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in transcriptional regulation. Binds to HOX or PBX proteins to form dimers, or to a DNA-bound dimer of PBX and HOX proteins and thought to have a role in stabilization of the homeoprotein-DNA complex. Isoform 3 is required for the activity of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element; MEIS2 is not involved in complex DNA-binding. Probably in complex with PBX1, is involved in transcriptional regulation by KLF4. Isoform 3 and isoform 4 can bind to a EPHA8 promoter sequence containing the DNA motif 5'-CGGTCA-3'; in cooperation with a PBX protein (such as PBX2) is proposed to be involved in the transcriptional activation of EPHA8 in the developing midbrain. May be involved in regulation of myeloid differentiation. Can bind to the DNA sequence 5'-TGACAG-3'in the activator ACT sequence of the D(1A) dopamine receptor (DRD1) promoter and activate DRD1 transcription; isoform 5 cannot activate DRD1 transcription.
Nucleus. Cytoplasm>Perinuclear region.
Expressed in various tissues. Expressed at high level in the lymphoid organs of hematopoietic tissues. Also expressed in some regions of the brain, such as the putamen.
Monomer and homodimer. Heterodimer with HOXB13 (Ref.16). Isoform 2 interacts with TLX1. Isoform 3 interacts with HOXA13 and PBX1 isoform PBX1b. Isoform 4 interacts with SP1, SP3 and KLF4. Isoform 4 and isoform 5 interact with PBX1 isoform PBX1a; the interaction partially relieves MEIS2 autoinhibition. Isoform 3 also known as MEIS2b is part of a PDX1:PBX1b:Meis2B complex; Meis2B is recruited by PBX1b and can be replaced by isoform 4 in a small fraction of complexes. Can form trimeric complexes including HOXB8 and PBX2 or PBX3.
Belongs to the TALE/MEIS homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.